KEGG   Methylocystis rosea: EHO51_01370
Entry
EHO51_01370       CDS       T05721                                 

Definition
(GenBank) PBP1A family penicillin-binding protein
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
mros  Methylocystis rosea
Pathway
mros00550  Peptidoglycan biosynthesis
mros01100  Metabolic pathways
mros01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:mros00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EHO51_01370
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    EHO51_01370
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mros01003]
    EHO51_01370
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mros01011]
    EHO51_01370
Enzymes [BR:mros01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     EHO51_01370
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     EHO51_01370
Glycosyltransferases [BR:mros01003]
 Polysaccharide
  Bacterial polysaccharide
   EHO51_01370
Peptidoglycan biosynthesis and degradation proteins [BR:mros01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   EHO51_01370
SSDB
Motif
Pfam: Transgly Transpeptidase
Other DBs
NCBI-ProteinID: AZG75497
UniProt: A0A3G8M1D8
LinkDB
Position
302254..304488
AA seq 744 aa
MLERFQASAFAKRLRRILLAIDARIDSAMYQSGRRARELYEDFSTFMERFHVSGLARVGV
ELSCEALTLGLGAGIVAMALASSAFQMTSDENWLKQTDLAVTFLDRYGAEVGQRGIKHDD
AVPLDQYPDYLIKAVLATEDRRFYEHFGIDVIGTLRALTVNARSSGVVQGGSSISQQLAK
NLFLSNERTITRKINEAFLALWLEHHLTKREILKLYLDRVYMGGGAFGIQAAAEFYFGKS
VKDVTLSEAAMLAGLFKAPTKYAPHVNLPAARARANDVLNNLVDSGFMTDSQIIAAQRSP
ATPIDRARETSPDWYLDYAYGEIRKFAQEGKLGDNRVLSVRTTLDSNVQKRAEDVIETNL
REQGRSFHVKQSAAVVMEPDGAVRAIVGGRDYGASQFNRATDAARQPGSSFKPYVYLTAL
MTGRFKPTTIVTDRPTCIGNYCVHNYSGGYAGSMPLAMALAKSLNTVAIQLSQAIGKGDS
RIGRAKIIETCRRLGITTPLEDTPSLPVGQSDVILLEHSAGYGAFVNGGKKVTPYAAVEI
RNRQGDLLYRHDRDAPPQTQAVPLDKVVELAGMMKKVVEEGTGKRAQLGEGIDVIGKTGT
TNGYKDAWFCGYSGTMGGCVWYGNDDNAPMNNMTGGTLPAGTWHDIMAYAHQGAILKPIV
GLKPDPKGATAAVNANVVKPLELGAPQRPATLSKGAIQALESLQTKIKAVGGDKQSALEA
PDPAASDAVRREAQRASGADGVIR
NT seq 2235 nt   +upstreamnt  +downstreamnt
gtgttggagcgtttccaggcttctgctttcgccaagcgcttgaggcgcatcctgctcgcg
atcgatgcgcgcatcgattccgccatgtaccagagcgggcggcgcgcccgcgaactctat
gaggatttttcgaccttcatggagcggttccatgtctccggccttgcccgggtcggcgtg
gagctctcctgcgaggcgctgactcttggtctaggcgccggcatcgtcgccatggcgctc
gcgtcctcggccttccagatgaccagtgacgagaactggctcaagcagaccgacctcgcg
gtcaccttccttgatcgctacggcgcggaagtcggccagcgcggcatcaagcatgacgac
gccgtgccgctcgatcaatatcccgactatctgatcaaggcggtgttggcgacggaagac
cgccgcttctacgaacatttcggcatcgacgtgatcggcacgctgcgggcgctcaccgtc
aacgcccggtcgtcaggcgtggtgcagggcggctcctccatcagccagcagctcgccaag
aatcttttcctgtcgaatgagcgcacgatcacccgcaagatcaacgaggcctttctggcg
ctgtggctcgagcaccatctgaccaagcgcgaaatcctcaagctctatctcgatcgcgtc
tatatgggcggcggcgccttcggcattcaggcggcggccgaattctatttcggcaagtcg
gtcaaagacgtcacgctctccgaggcggcgatgctcgccggcctcttcaaggcgccgacg
aaatatgcgccgcacgtcaatctgccggcggcgcgcgcgcgcgccaatgacgtcttgaac
aatctcgtcgactccggcttcatgaccgatagccagatcatcgcggcgcagcgcagtccg
gcgacgccgatcgaccgcgcccgcgagacgagccccgactggtatctcgattacgcctat
ggcgaaatccgcaagttcgcgcaggaaggtaagctcggcgacaatcgcgtgctcagcgtg
cgcaccacgctcgactccaacgtccagaagcgcgccgaagacgtcatcgaaaccaatttg
cgcgagcagggccgcagcttccatgtcaagcagagcgccgcggtcgtcatggagccggac
ggcgccgtgcgcgccatcgtcggcggacgggattatggcgcaagccagttcaatcgcgcg
accgacgccgcgcgccaaccgggctcctccttcaagccctacgtctatctcaccgcgctg
atgaccggccgtttcaagccgacgaccatcgtcaccgaccggccgacctgcatcggcaat
tactgcgtccataattacagcggcggctatgccggctcgatgccgctcgccatggcgctg
gcgaaatccttgaacacggtcgccattcaactgtcgcaggcgatcggcaagggcgattcg
cgcatcggccgcgccaagatcatcgaaacctgccggcggctcggcatcaccacgccgctc
gaagacacgccctcgcttccggtcggacagagcgacgtgatcctgctcgaacattcggcg
ggctacggggcattcgtcaacggcggcaaaaaggtcacgccttacgccgccgtcgaaatc
cgcaaccggcagggcgatctgctctatcgccacgaccgcgacgcgccgccgcaaacgcag
gcggtgccgctcgacaaggtcgtcgaactcgccggcatgatgaagaaggtcgtcgaggaa
ggcaccggcaagcgcgcgcagctcggcgagggcatcgacgtgatcggcaagaccggaacg
acgaatggctataaggacgcctggttctgcggctattccggaacgatgggcggctgcgtt
tggtacggcaatgacgacaacgcccctatgaacaacatgaccggcggcacgctgccggca
ggcacttggcacgacatcatggcctatgcgcatcagggcgcgatcctgaagcccattgtc
ggcttgaagccggatcccaagggcgcgacagccgccgtgaacgccaatgtcgtcaagccg
ctcgaacttggcgcgccgcagcgtcccgcgaccttgtcaaagggcgcgatacaggcgctg
gaatcgcttcaaacgaaaatcaaagcggtcggcggcgacaagcagagcgcgctcgaagcg
cctgaccccgccgcatccgacgctgtgcggcgcgaggcgcagcgcgcgagcggcgccgac
ggcgtcatccgttaa

KEGG   Methylocystis rosea: EHO51_09930
Entry
EHO51_09930       CDS       T05721                                 

Definition
(GenBank) penicillin-binding protein 1A
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
mros  Methylocystis rosea
Pathway
mros00550  Peptidoglycan biosynthesis
mros01100  Metabolic pathways
mros01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:mros00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EHO51_09930
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    EHO51_09930
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mros01003]
    EHO51_09930
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mros01011]
    EHO51_09930
Enzymes [BR:mros01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     EHO51_09930
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     EHO51_09930
Glycosyltransferases [BR:mros01003]
 Polysaccharide
  Bacterial polysaccharide
   EHO51_09930
Peptidoglycan biosynthesis and degradation proteins [BR:mros01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   EHO51_09930
SSDB
Motif
Pfam: Transgly Transpeptidase PCB_OB
Other DBs
NCBI-ProteinID: AZG77023
UniProt: A0A3G8M4Y7
LinkDB
Position
2043085..2045490
AA seq 801 aa
MRMLARFLGFVFATATIVFLIGAIAGSGLIYYFSKDLPDTAQLRDYEPPVTTRLHAGDGS
ILAEYSHERRLFLPSSAIPQLVKQAFISAEDKNFYNHVGIDPEGVMRAVTVLAQGGRHVQ
GASTITQQVAKNFLVGNERSIERKIREALVAFRIEAAYPKDKILELYLNEIYLGLGNYGV
AAAALNYFNKSVNELTLAEAAYLAALPKAPSNYHPFQNRERAIERRNYVIDRLIADGYVT
ADEGAKAKAEPLGVNPRVLSPNTYVAGYFAEEVRRQLLEQQSEKKLYEGGLSVRTTLDPK
MQALTRKALADGLVRYDEAHGFRGAMNHIDISSDWGVTLAAIPALGDVKPWRLAVVLDVT
GDAARIGLQPGREKFGEVARERETGLLTAEGMRWSGRTPRTALTTGDVIYVEPLAGRAGQ
YRLRQIPDISGAMVAMDPHTGRVFSMVGGFSFDQSSFNRATQALRQPGSSFKPFVYATAL
DNGYTPSSSILDEPISIQQADGTYWTPENFEGGHGTGAHPLRYGIEHSKNMMTVRLAKDV
GMPLIAEYAKRFGVYDEMTPYLSMALGAGETTLLRMVTGYSMLANGGKRIKPTLIDRIQD
RWGKTVYRHDERQCIGCDSAKWENQLEPKLIDKREQVLDPLTAYQITSIMEGVIQRGTGV
SIRSVGKHLAGKTGTTNDAKDLWFVGFSPDLAVGVFIGYDRPRSLGSHAQAAQFAAPIFR
DFMTVALKDKPDTPFRVPPGIKLISIDVHSGLRSSGAGTILEAFKPGTAPPDSYSGGGGP
RQLDTPHDVDQQVGSGTGGLY
NT seq 2406 nt   +upstreamnt  +downstreamnt
atgcgaatgctcgcaaggtttttgggcttcgtcttcgcgaccgcgacgatcgttttcctc
atcggagcgatcgccgggtccgggctgatctattatttttccaaggatctgcccgacaca
gcccagttgcgcgactacgagccgccagtgacgacaaggctgcacgccggcgacgggtcg
atcctcgccgaatattcacatgaacgccgcctgttcctgccgagttccgccattccgcag
ctggtgaaacaggcgttcatctccgccgaagacaagaatttctacaaccacgtcggcatc
gatccggaaggcgtgatgcgcgccgtaacggtgctcgcccagggcggccgccatgtgcaa
ggcgcctcgaccatcacgcagcaggtcgccaagaacttcctcgtcggcaacgagcgctcg
atcgaacgcaagattcgcgaagcgctcgtcgccttccgcatcgaagcggcctatcccaag
gacaagattctcgagctttatctcaacgagatctatctcggccttggaaactacggcgtc
gccgccgcggcgctcaactacttcaacaaatcggtcaatgagctcacgctcgccgaggcg
gcctatctcgccgcgcttcccaaggcgccgagcaattatcatccgttccagaaccgcgag
cgcgccatcgagcgccgcaactacgtgatcgatcgactgatcgccgacggctatgtgacc
gccgacgaaggcgcgaaggcgaaagccgagccgcttggcgtcaatccgcgcgttctctcg
cccaacacttatgtcgcgggctatttcgccgaggaagtgcgccgtcagttgctggagcaa
caaagcgagaagaagctctatgaaggcgggctgtcggttcgcacgacgctcgaccccaag
atgcaggccctcacgcgaaaggcgttggccgacggcctcgttcgctacgacgaggcgcat
ggcttccgcggcgcgatgaaccacatcgacatctcttccgactggggcgtgacgctcgcg
gccattcccgcgcttggcgacgtcaagccatggcgcctcgccgtcgtgctggatgtgacc
ggcgacgccgcgcgcatcggccttcagccgggacgcgagaaattcggcgaagtggcgcgc
gaacgcgagaccggccttctcacggccgaaggcatgcgctggagcggccgcacgccgcga
acggccttgacgacgggcgacgtgatctacgtcgaaccgctcgcgggacgcgccggccaa
tatcgtctgcgccagatccccgacatctccggcgcaatggtggccatggacccgcatacg
ggccgcgtcttctccatggtcggcggcttttccttcgaccagtcgtcattcaatcgcgcg
actcaggcgttgcgccagcccggctcctcgttcaagcccttcgtctatgcgacggcgctc
gacaatggctatacgccgtcgtcgtccatcctcgacgagccgatttccatccagcaggcg
gacggcacctattggacgcccgagaatttcgaaggcggccacggcaccggcgcgcatccg
ttgcgctacggaatcgagcattccaagaacatgatgacggtgcgtctggcgaaagacgtc
ggcatgccgctcatcgccgaatacgccaagcgctttggcgtctacgacgagatgacgccc
tatctgtccatggcgctcggcgccggcgaaacgacgctgctccgcatggtcaccggctat
tcgatgctggcgaatggcggcaagcgcatcaagcccacgctgattgaccgcattcaggat
cgctggggcaagacggtctaccgacatgacgagcgtcaatgcatcggctgcgactccgcc
aaatgggagaatcagctcgaaccgaaactgatcgacaagcgcgaacaggtgctcgatccg
ctcaccgcctatcagatcacctcgatcatggaaggcgtgatccagcgcggcaccggcgtc
tcgatcagatcggtcggcaagcaccttgccggcaagaccggcacgacaaacgacgcaaaa
gatctttggttcgtcggcttctcgcctgacctcgcggttggcgtcttcatcggctacgat
cggccgcgctcgctcggcagccacgcccaggccgcgcagttcgccgcgccgatcttccgc
gacttcatgaccgtggctctgaaggacaagcccgatacgccgttccgtgtgccgccgggg
atcaagctcatttccatcgacgtgcactccgggctgcgttcgtcgggagccggcacgatt
ctcgaggcgttcaagccgggaacggcgccgcccgactcctactccggcggcggcggcccg
cgtcagctcgatacgccgcatgacgtggatcagcaggtcggcagcggcaccggcggcctc
tactaa

KEGG   Methylocystis rosea: EHO51_15355
Entry
EHO51_15355       CDS       T05721                                 

Definition
(GenBank) penicillin-binding protein 1A
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
mros  Methylocystis rosea
Pathway
mros00550  Peptidoglycan biosynthesis
mros01100  Metabolic pathways
mros01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:mros00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EHO51_15355
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    EHO51_15355
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mros01003]
    EHO51_15355
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mros01011]
    EHO51_15355
Enzymes [BR:mros01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     EHO51_15355
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     EHO51_15355
Glycosyltransferases [BR:mros01003]
 Polysaccharide
  Bacterial polysaccharide
   EHO51_15355
Peptidoglycan biosynthesis and degradation proteins [BR:mros01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   EHO51_15355
SSDB
Motif
Pfam: Transgly Transpeptidase
Other DBs
NCBI-ProteinID: AZG78003
UniProt: A0A3G8M7Q3
LinkDB
Position
complement(3162400..3164649)
AA seq 749 aa
MARSDKRREPRFDDDDDGELRAERRPPPRSRARKTPRRSRSLFGALIYWSFTLALWGAIA
GGGLAVYYGARLPPIDQLAVPKRPPNIAILDVNGELLANRGDTGGAAIRLADLPPYVPKA
FIAIEDRRFYSHWGVDPIGIGRAIVRNVTGRGGMQGGSTLTQQLAKNLFLTQERTISRKI
QEAILALWLEHKYSKDQILELYLNRVYFGSGAYGVEAAAERYFGHGAKTITLSEAAVLAG
LMKAPSKLAPDRNPEGAAERAAQVIAAMAQEGHISESTATTALSHSARARSDIGAGSINY
AADYVMDMLDDTIGAIDQDIVVTTTIDARMEMAAEGALKQELDEKGAKFGVAQGAIVALD
PTGAIRALVGGRDYSASQFNRAVSAKRQPGSAFKPFVYLTGLEQGLTPESVREDGPLDVK
GWRPENYSRQYLGPVTLTKALSLSLNTVAVRVGLEVGPKAVAKTAHRLGVQSDLQANASI
ALGTSEVTPLELVAAYTPFANGGIGVQPHVILKVKTAAGKTLYQRKNASLGRVIAPQYVA
MMNDMMRETLLTGTARKAELPGWNAAGKTGTSQDFRDAWFVGYTGRLVAGVWLGNDDNSP
TKKASGGNLPVEIWSRFMSVALKGQPVAGLPAGAWRSENITLPEEIAKPMDDLIGLFTGE
SRPAPRPQSARTTPAPRPPAHIPADSPDQPPVAEASPAPRDAPPRSPPPRAIDDLLPPED
IPTVGSIERPRQRRGAPDRSIFEDLFGGG
NT seq 2250 nt   +upstreamnt  +downstreamnt
atggcgcgcagcgataagcgtcgcgaaccgcggttcgacgacgacgatgacggcgaattg
cgcgccgagcgccgtccgccgccccgttcgcgcgcccgcaaaacgccgcgccgctcccgc
tcgctcttcggcgcgctgatctactggagcttcacgctggcgctctggggagccatcgcc
gggggcggcctcgccgtctattacggcgcgcgactgccgccgatcgatcagctggcggtg
cccaagcgcccgcccaatatcgccatcctcgacgtgaacggcgaactcctcgccaaccgc
ggcgacaccggcggcgcggcgatccggctcgcggacctcccgccctatgtcccaaaggcc
ttcatcgccattgaggatcgccgtttctattcgcattggggggtcgatccgatcggcatc
ggccgcgccatcgtccgcaacgtcacgggccgcggcggcatgcagggcggctcgaccctg
actcagcagctcgccaaaaacctgtttctgacccaggagcgcaccatctcgcgcaagatc
caggaggcgatcctcgcgctctggctcgagcacaaatactcaaaggaccagatcctcgaa
ctctacctcaaccgcgtctatttcgggtccggcgcctatggcgtcgaagccgcggcagag
cgttacttcggccatggcgcgaaaaccatcaccttgtctgaagccgccgtcctcgccggg
ctgatgaaggcgccgagcaagcttgcgccggatcgcaatccggagggagcggccgagcgc
gcggcgcaggtgatcgccgccatggcgcaggaaggccatatcagcgagtcgacggcgacg
acggcgctgtcgcattccgcacgcgcgcggagcgacatcggcgcagggtcgatcaattac
gccgccgactatgtcatggacatgctcgacgacacgatcggcgcgatcgaccaggacatc
gtcgtcacaacgacgatcgacgcgcgcatggagatggcggcggaaggcgcgctcaagcag
gagctcgacgagaaaggcgcgaaattcggcgtcgcccagggcgcgatcgtcgccctcgat
cccacaggcgcgatccgggcgctcgtcggcggacgcgactattcggccagccagttcaat
cgcgcggtctcggcgaaacgccaacccggctccgccttcaaaccctttgtctatctgacg
gggctcgaacagggacttacccctgagtccgtgcgcgaggatgggccgctcgacgtcaaa
ggctggcggcccgaaaactacagccgtcaatatctcggacccgtcacgctcaccaaggcg
ctgtcgctgtcgctcaacaccgtggccgtgcgcgtgggcctcgaagtcggccccaaggcc
gtggcgaagactgcgcatcgcctcggcgtccagtccgacctgcaggcgaacgcttcgatc
gcgctcggcacgtcggaggtgacgccgctggagctcgtcgccgcctatacgcctttcgcc
aatggcgggatcggcgtccaaccgcatgtcattctcaaggtgaagaccgccgccggcaag
actctctatcagcgcaagaatgcgtcgctcggccgcgtcatcgcgccgcaatatgtggcg
atgatgaacgacatgatgcgcgagacgctgctcaccggcaccgcccgcaaggccgagctt
ccgggatggaacgccgccggcaaaaccggcacgagccaggatttccgcgacgcctggttc
gtcggctacacgggccggctggtcgcgggcgtctggctcggcaacgacgacaactcgccg
acgaaaaaagcttccgggggcaatctgccggtcgaaatctggagccgcttcatgagcgtc
gccttgaagggccaacccgtcgccggactgcccgcgggcgcctggcggtcagagaacatt
acgctccccgaggagatcgccaagccgatggatgacctcatcggcttgttcaccggggag
tcgaggcctgcgccccggccgcagtccgcgagaacgacgccggcgccgcgaccgcccgcg
catatccccgccgactcgcccgaccaaccgcccgtagcggaggcgtcgcccgcgccacgc
gacgctccgcccaggtcgccgccgcctcgcgcgatcgacgatcttctgccgccggaagac
atcccgacggtcggctcgatcgaacggccgcggcagaggcgcggggcgccggatagaagc
atattcgaggatctcttcggcggcggctga

DBGET integrated database retrieval system