KEGG   Methylocystis rosea: EHO51_01490Help
Entry
EHO51_01490       CDS       T05721                                 

Gene name
ligD
Definition
(GenBank) DNA ligase D
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
mros  Methylocystis rosea
Pathway
mros03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:mros00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    EHO51_01490 (ligD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mros03400]
    EHO51_01490 (ligD)
Enzymes [BR:mros01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     EHO51_01490 (ligD)
DNA repair and recombination proteins [BR:mros03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     EHO51_01490 (ligD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_C DNA_ligase_A_M DNA_primase_S RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AZG75520
LinkDB All DBs
Position
complement(325637..328195)
Genome map
AA seq 852 aa AA seqDB search
MSLADYRRKRDFGATGEPKGRGARKTGSRFVIQKHAARRLHYDLRLEMDGVLKSWAITRG
PSLVPGEKRLAVHVEDHPLDYRDFEGVIPEGQYGAGEVIVWDKGVWIPEGDPHKGYAKGH
LDFELRGEKLGGRWHLVRMARKPREKHDNWLLIKSEDEFARAPEDEDILEEMPRSVDTGR
TIGDVADGKPARRSKKAAAPKQAAAPRSIRTSAVAPTQAPAVDIDPSRLKGAKKAPLPNF
VAPMQASSGAAPASKEWIHEIKFDGYRVQARIEAGRVRLLSRSGLDWTKKFGDEVASALR
ALPLGAALIDGEIVVETSSGASDFSGLQADLSAGRTDRFVYWVFDLLCLDGYDLRGATLL
ERKRLLEALLGAENGDRVRLSLHFEDSGAVVLSHACRLGLEGVVSKLRDSPYRSGRVKSW
IKAKCFARQEFVVAGYTPSTVSRRAIGALVLGVYQNGVLCHVGRVGTGFTADMAQELFTR
LDPMRTSSSPFGARLSTEAARNVRYVRPELVAEVEFRGWTGDQNLRHASFRGLREDKDAR
DVVREKAPPVERATAARVEQSAVRLTHPDRLYWPDQGVTKQGLADYYAEIWRYIAPFIVN
RPLALLRCPNGVEGEKFFQKHAWKGIDPNIVLIDDPKGEEDPLLSIKDLNGLIALVQSGT
LEIHPWGSTASDWERPDVIIMDLDPGEEVAWESVIAAAEETRDRLQDLGLAAFVKTSGGK
GLHVVAPVKPKAEWPEVKAFTKGIADAMTHDSPSKYVATITKSKRRGKILVDYLRNQRGA
TAVAPYSTRARPGAAVSVPLSWDELSPAIGPDYFTIAKTLARLESLQSDPWEGFRQAAAP
IETPKTRKKRKV
NT seq 2559 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctcgccgactaccgcaggaagcgcgattttggggcgacgggcgagccgaagggg
cgaggcgcgcgaaagaccggcagccgcttcgtcatacagaaacatgccgcgaggcggctg
cattacgatcttcgcctagagatggacggcgttctgaaaagctgggccatcaccagaggt
ccaagccttgtgcccggcgaaaagcggcttgctgttcacgtcgaggaccaccctctcgac
tatcgcgacttcgaaggcgtcattccggaaggccaatatggcgccggcgaagtgatcgta
tgggacaagggcgtgtggattcccgaaggcgatccgcacaagggctatgccaagggccac
ctcgatttcgaattgcgcggcgaaaagctcggcggccgttggcatctcgtgcgcatggcg
cgaaaaccgcgcgagaagcacgacaactggcttctcatcaaaagcgaggacgaatttgcg
cgtgcgcctgaagacgaggacatacttgaggagatgccgcgttcggtagacaccgggcgc
acgatcggtgatgtggcagacggcaagccggcgcggcgctcgaaaaaagccgccgcgcca
aagcaggccgccgcgccccggtcaatcaggacaagcgccgtcgcgccaacgcaagcgcct
gcggtggacatcgacccgtcgcgtctcaagggcgcaaagaaggcgccgctgccgaatttc
gttgcgccgatgcaggccagttccggcgccgcgccggcgagtaaggaatggattcacgaa
atcaaattcgacggctatcgcgtgcaggcgcgcatcgaggcgggacgcgtacggttgctc
tcacgcagcggtctcgattggacgaagaaattcggcgatgaggtcgcgtcagcgctgcgc
gccctgcctctcggcgccgcgctcatcgacggcgaaatcgtcgtcgagacgagttcaggc
gcgtcggatttctctgggctgcaggccgatctgagcgcagggcggaccgatcgcttcgtc
tattgggtcttcgatcttctttgcctcgacggatacgatctgcgcggcgcgaccttgctg
gaacgcaaaaggttgctggaagcgctcttgggcgctgagaacggcgacagggttcgtctg
agccttcactttgaggacagtggcgcggtcgtgctgtcgcacgcgtgtcggctcggtctc
gaaggcgtggtgtcgaagctgcgggattcgccctatcgctctggccgcgtgaagagctgg
ataaaggccaaatgcttcgcgcggcaggaattcgtcgtcgcaggctatacgccgtcgacg
gtgtcgcgtcgggcgatcggcgccctcgtgcttggcgtctaccagaatggcgtgctttgc
catgttggccgcgttggcacaggatttacggccgatatggcgcaggagcttttcacgaga
ctcgatcccatgcgcacctcctcgagccctttcggcgcgcgcctcagtacggaggccgcg
cgcaatgtacgctacgtgcggcccgaactggtcgctgaggtggaatttcgcggctggacg
ggcgatcaaaatcttcggcacgcctcctttcgcggtctgcgcgaagataaggacgcgcgc
gacgtcgttcgcgaaaaggcgccgcccgttgagcgggcgacagcggcgagagtggagcaa
agcgccgtgaggctcacccatcccgatcggctctattggccggatcaaggcgtcaccaaa
cagggcctcgccgattactacgccgaaatctggcgctatatcgcgcccttcatcgtcaat
cgcccgctggcgctgctgcgttgccccaacggcgtcgagggagagaagttcttccagaag
catgcctggaagggcatcgatccgaacatcgtgctcatcgacgacccgaaaggcgaagaa
gaccccttgctcagcatcaaggatctcaacggcctgatcgcgctcgttcaatccgggacc
ctggaaattcatccctggggctcgacggcgtcggactgggagcgtcctgacgtcatcatc
atggatctcgatcccggcgaagaggttgcgtgggagtccgtcattgcggcagcggaagaa
acgcgggaccgactccaagaccttgggctcgccgccttcgtgaaaacatccggcggaaag
ggccttcatgtggtggcgcccgtgaagcccaaagcggaatggccagaggtgaaggctttc
accaaaggcatcgccgatgcgatgacacatgacagcccgagcaaatatgttgcaacgatc
acgaaatcgaagcgccgcggaaagatactcgtcgactatctgcgcaatcagcgcggcgcg
acggctgtcgcgccctactccacgcgcgctcgtccgggagccgccgtctcggtcccgctc
tcctgggacgaacttagtccggcgatcggacctgactatttcacgatcgcgaaaaccctc
gcgcgcctcgagtcgctgcagagcgatccgtgggaaggctttcgtcaagcggcggcgccg
atcgaaacgccgaagacgcggaaaaagagaaaagtctag

DBGET integrated database retrieval system