KEGG   Methylocystis rosea: EHO51_03355
Entry
EHO51_03355       CDS       T05721                                 

Definition
(GenBank) isoprenyl transferase
  KO
K00806  undecaprenyl diphosphate synthase [EC:2.5.1.31]
Organism
mros  Methylocystis rosea
Pathway
mros00550  Peptidoglycan biosynthesis
mros00900  Terpenoid backbone biosynthesis
mros01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mros00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EHO51_03355
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    EHO51_03355
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:mros01006]
    EHO51_03355
Enzymes [BR:mros01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.31  ditrans,polycis-undecaprenyl-diphosphate synthase [(2E,6E)-farnesyl-diphosphate specific]
     EHO51_03355
Prenyltransferases [BR:mros01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   EHO51_03355
SSDB
Motif
Pfam: Prenyltransf
Other DBs
NCBI-ProteinID: AZG75850
UniProt: A0A3G8M488
LinkDB
Position
724829..725608
AA seq 259 aa
MTESDILEAQTNAQRARAAPRHVALIMDGNGRWAAKRGLPRFEGHRRGVEALRRTVRAAI
KLNIGYLTVYSFSAENWSRPREEVESLLSLLHRFIRNDLAELHASNVRVRVIGARAELAP
DISDLLREAEQMTQANSGLTLVVAFNYGARQEIAAAARALAEMVAQGRLRPEEIDADAIA
QRLDTADIPDPDLIIRTSGEQRLSNFLLWQAAYAEFVFLPILWPDFDEGALAAAIAEYAH
RDRRFGGLEAAARSAKTAS
NT seq 780 nt   +upstreamnt  +downstreamnt
atgacggaaagcgacattctggaggcgcaaacgaacgcgcagcgcgcgcgcgcggcgccg
cgtcatgtcgcgctgatcatggacggcaacggccgctgggcggccaagcggggcttgccg
cgattcgaagggcaccggcgcggcgtcgaggcgctgcgtcgcacggtgcgggcggcgatc
aagctcaacatcggctatctgacggtctattccttctcggcggaaaactggtcgcgcccg
cgcgaggaggtggaaagcctcctctcgctgctgcatcgcttcatccgcaacgatctagcg
gagttgcacgcgagcaatgtgcgcgtgcgggtcatcggcgcgcgcgccgagctcgcgcct
gacatctcggacctgctgcgcgaggccgagcagatgacgcaggcgaactccgggctcacg
ctcgtcgtcgcgttcaactatggcgcgcggcaggagatcgcggcggcggcccgcgcgctc
gcggaaatggtggcgcaaggccgactgaggcctgaggagatcgacgccgacgccatcgcg
cagcggctcgacacggcggacattcccgaccccgacctgattatccgcacgtcgggcgag
cagcggctgtcgaatttcctgctgtggcaggcggcttacgccgaattcgtcttcttgccg
attctttggcccgatttcgacgagggggcgctggcggccgcgatcgccgaatacgcgcat
cgcgatcggcgcttcggcgggcttgaagctgcggcgcgcagcgccaagaccgcgtcatga

DBGET integrated database retrieval system