KEGG   Methylocystis rosea: EHO51_06695
Entry
EHO51_06695       CDS       T05721                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
mros  Methylocystis rosea
Pathway
mros00550  Peptidoglycan biosynthesis
mros01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mros00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EHO51_06695
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mros01002]
    EHO51_06695
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mros01011]
    EHO51_06695
Enzymes [BR:mros01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     EHO51_06695
Peptidases and inhibitors [BR:mros01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   EHO51_06695
Peptidoglycan biosynthesis and degradation proteins [BR:mros01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   EHO51_06695
SSDB
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Peptidase_S13 Transpeptidase
Other DBs
NCBI-ProteinID: AZG76444
UniProt: A0A3G8M477
LinkDB
Position
1381666..1382853
AA seq 395 aa
MPKFPGLHLILTLFALGALGAAPSRAQNFQTSVPHAILIDAGTNTVLFEKGADDYAKPAS
TVKILTAELIFQALAEGKLKLDDEFTVSEHAWRTGGAPAGGSAMFLALNSRVRVEDLIRG
LVIQSGNDAAITLAEGLAGAEESFVTRMNKRAAELGLVKSRFGNPWGMDGPDQKVTAREM
AKLAAHMIKTYPEYYRYFGEKEYTWNKIRQQNRNPLLTMSIGADGLKTGNIDKDSGYGLV
GSATQDGRRLIVAVYGAKSAKERAEEARKLLQWGFRNFEEKELFKAGEPIGPAQVYGGTK
GSVELTAKEDIKVLLPRGANERLMGKIVYEGPVLAPVEAGATVGRLEVKRGNSVVLEQPL
QTVESVEQGSLPRRAFDAIYESAAAAIHQKLSGKK
NT seq 1188 nt   +upstreamnt  +downstreamnt
ttgccgaaatttcccgggcttcaccttattctgacgcttttcgcattgggggcgcttggg
gcagcgccgtcgcgcgcccagaattttcaaacgagcgtcccgcacgccatcctgatcgac
gctggcacgaacaccgttctgttcgagaaaggcgccgacgactacgccaagcccgcatcg
accgtcaaaattctgacggcggagctgatctttcaggctttggcggaaggaaaactgaag
ctcgacgatgaattcacggtttccgagcacgcctggcgcaccggcggggcgccggctggc
ggctctgcgatgttcctcgcgctcaacagccgagtgcgggtcgaggatctcatccggggc
ttggtgatccagtccggcaacgacgcggcgattacgctcgccgaaggcctcgcaggggcc
gaagaatccttcgtgacgcggatgaacaagcgcgccgccgagcttggccttgtcaaatcg
cgcttcggcaatccctggggcatggacgggcctgaccaaaaggtgacggcgcgcgaaatg
gcgaagctcgcggcgcacatgatcaagacctaccccgaatattaccgctattttggcgag
aaagaatatacttggaataagattcgccaacagaaccgcaatcctttgttgacgatgagc
atcggcgctgacgggttgaagaccggcaatatcgataaggacagcggctacggcttggtg
ggctccgccacgcaggacggccgacgcctgatcgtcgccgtttacggcgcgaagagcgcg
aaggaacgggctgaagaagcgcgcaaattgctgcaatggggattccgcaacttcgaagag
aaggagcttttcaaggccggcgaacccatcgggcccgcgcaggtctatggcggcacgaag
gggtccgtcgagctgacggcgaaagaggacatcaaggtgcttctgccacgcggcgcgaac
gagaggctgatgggcaagatcgtttacgaaggccctgtgctggcgccggtcgaggcgggc
gcaacggttggacgcctcgaagtgaaacgcggaaattccgtcgtgctcgaacagccgttg
cagactgtggaatcggtcgagcagggatcgctgccgcggcgcgccttcgacgctatttac
gaatccgccgccgcggccattcaccagaaactctccggcaagaaatga

DBGET integrated database retrieval system