Methylocystis rosea: EHO51_06890 Help Entry EHO51_06890       CDS       T05721                                  Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism mros  Methylocystis rosea Pathway mros02024   Quorum sensing mros03018   RNA degradation Brite KEGG Orthology (KO) [BR:mros00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     EHO51_06890  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     EHO51_06890  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:mros03019]     EHO51_06890    03036 Chromosome and associated proteins [BR:mros03036]     EHO51_06890 Messenger RNA biogenesis [BR:mros03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      EHO51_06890 Chromosome and associated proteins [BR:mros03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     EHO51_06890 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Motif Other DBs NCBI-ProteinID:  AZG78542 UniProt:  A0A3G8MBK0 LinkDB All DBs Position complement(1421100..1421363) Genome browser AA seq 87 aa AA seqDB search MSSERSQNLQDTFLNFVRKNKVPLTIFLVNGVKLQGIVTWFDNFCLLLRRDGHSQLVYKH AISTIMPGHPIQMFEPGDDESQADKQR NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgtcgtcagagcgttcgcagaatctgcaagatacatttttgaatttcgtcaggaagaat aaagtcccgctcaccatcttcctcgtcaatggcgtcaagctccagggaatcgtcacctgg ttcgataatttttgcctgttgctgcgacgagacgggcattctcagctcgtctacaagcac gccatctcgacgatcatgcccggacaccccatacaaatgtttgagccgggcgacgacgag agccaggccgacaaacagcggtag

DBGET integrated database retrieval system