KEGG   Methylocystis rosea: EHO51_09080Help
Entry
EHO51_09080       CDS       T05721                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
mros  Methylocystis rosea
Pathway
mros00564  Glycerophospholipid metabolism
mros01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mros00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    EHO51_09080
Enzymes [BR:mros01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     EHO51_09080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C Pyr_redox_2 FAD_binding_2 NAD_binding_8 Lycopene_cycl FAD_oxidored GIDA Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AZG76871
UniProt: A0A3G8M4L1
LinkDB All DBs
Position
complement(1857876..1859342)
Genome map
AA seq 488 aa AA seqDB search
MIYDLLIVGGGINGCAIARDAAGRGLAVRLVEQGDLAQGTSSASTKLIHGGLRYLELYEF
RLVHEALAERELLLAAAPHIIWPLKFVLPYEKGLRPVWLLRLGLFIYDHLARRKQLEASH
MVTLSQDALGAPLRDAYRVGFTYADCWVDDSRLVVLNARDAAERGATISVGARLVHAERR
SDGWRATLADGETIQTRTLVNAAGPWVSQVIEDALRIPSRKHVRLVKGSHLVLRKFFEGA
QAYILQNPDGRIVFAIPYEREFTLVGTTDVSYDGPPGAVAISDAETDYLLNSLNHFLRVP
ATRDDIVSSYAGLRPLYDDGALKASVVTRDYAFDLDASEDAAPSLSIFGGKITTARRLAE
HALSELSRFLPAHGDAWTADAIFPGGDMPEGFDSFLADLKRDKPFLGDALALRLARAYGT
RVFEILKDARELSDLGRDFGCGLTEAEIAYLREKEWARTADDILWRRSKLGLHMSAAQQR
ALREFIGA
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgatctacgatcttctcattgtcggcggcggcattaacggctgcgccatcgcccgcgac
gccgccggccgcggcctcgccgtcaggctcgtcgagcagggcgatctcgcgcaaggcacc
tcgtccgcctcgacgaagctcatccatggcggtctgcgctatctcgagctctacgaattt
cgcctggtgcatgaagcgctcgccgaacgcgaactgctgctcgccgccgcgccgcacatc
atctggccgttaaaattcgttctgccctatgaaaaagggctgcggcccgtctggctgctg
cgtctcggacttttcatttacgaccaccttgcgcgccgcaaacagctcgaagcctcgcat
atggtgacgctttcgcaggatgcgctcggcgcgccgctacgcgacgcttaccgcgtcggc
ttcacttacgccgattgctgggtggatgattcgcgcctcgtcgtgttgaacgcgcgcgac
gcggcggaacgcggcgcgacgatcagcgttggcgcaaggctcgttcacgcagaacggcgc
agcgacggctggcgcgcaacgctcgcggacggcgagacgattcaaacgcgcacgctggtc
aacgccgccggcccctgggtgtcgcaggtgatcgaagacgcgctgcgcatcccttcgcgc
aaacatgtgcggctcgtgaagggctcgcatctcgttctgagaaagttcttcgaaggcgcg
caggcctatattctgcagaaccccgacgggcgcatcgtctttgcgatcccctatgagcgc
gagttcacgctcgtcggcaccacggacgtctcttatgacggtccgcccggcgccgtggcg
atcagcgacgcggagacagactatctcctcaattcgctcaatcatttcttgcgcgttcca
gcgacccgcgacgacattgtgtccagctacgccgggcttcggccgctttacgacgacggg
gcgctgaaagcttcggtcgtgacgcgcgactatgctttcgatctcgacgcgtccgaagat
gcggcgccgtcgctgtcgatctttggcggcaagatcaccaccgcgcgccggcttgccgaa
catgcgctgagtgaactctcgcgctttcttcccgcgcatggcgacgcctggacggccgac
gcgatctttcccggcggcgacatgccggagggcttcgacagctttcttgccgatctcaaa
cgcgacaagccctttttaggagatgcgttggcgctgcgccttgcgcgcgcctatggaacg
cgagtcttcgagatattgaaggatgcccgggagttgagcgatcttggccgtgatttcggc
tgcggcctcaccgaggcggagatcgcctatctgcgcgagaaggaatgggcgcgcacggct
gacgacattctctggcgccgctccaagctcggcctccatatgagcgccgcgcagcagcgg
gcgctgcgggaattcatcggcgcctga

DBGET integrated database retrieval system