KEGG   Methylocystis rosea: EHO51_09365Help
Entry
EHO51_09365       CDS       T05721                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
mros  Methylocystis rosea
Pathway
mros00473  D-Alanine metabolism
mros00550  Peptidoglycan biosynthesis
mros01100  Metabolic pathways
mros01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mros00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    EHO51_09365
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EHO51_09365
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    EHO51_09365
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mros01011]
    EHO51_09365
Enzymes [BR:mros01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     EHO51_09365
Peptidoglycan biosynthesis and degradation proteins [BR:mros01011]
 Precursor biosynthesis
  Amino acid ligase
   EHO51_09365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 CPSase_L_D2 IlvN
Motif
Other DBs
NCBI-ProteinID: AZG76923
UniProt: A0A3G8M4P1
LinkDB All DBs
Position
complement(1924330..1925253)
Genome map
AA seq 307 aa AA seqDB search
MTKHVAVLMGGLSAEREISLRSGEACAKALEEQGFQVSRVDAGHDVANVLAALKPDVAFN
ALHGKFGEDGCIQGALELLRIPYTHSGVLASSVAMKKDIAKTVMAAAGVPTPKGRVLHRL
DAAKAHALPLPYVLKPVSEGSSFGVFIVSEGQEHPPQELWREDWTHGDMMLAEQFIAGRE
LTCAVMNDKALDVIEILAADGGWYDYHAKYAKGGSKHVLPANLKQNIYQEVQHLALEAHR
ALGCRGVSRADFRYDDRPGGTGELVVLEVNTQPGMTETSLVPEMAAYAGFSFGELVRWMV
EDASCDR
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagcacgtcgccgttctgatgggcggactctccgccgaacgcgaaatttccttg
cgctcgggcgaagcctgcgcgaaagccctcgaagagcagggatttcaagtgtcccgcgtc
gacgcggggcatgacgtcgcaaatgttcttgcggcgctcaaacccgatgtcgccttcaac
gcgcttcatggcaagtttggcgaggacggctgcattcagggcgcgctggagcttctgcgc
atcccctacacgcactcgggcgtgctcgcctcttcggtggcgatgaaaaaggatatcgcg
aagacggtgatggcggcggccggcgttccgacgccaaaagggcgcgttctgcacaggctc
gacgccgccaaagcgcacgcgctgccccttccatatgtcctcaagcccgtttccgaaggc
tcctccttcggcgtcttcatcgtcagcgagggccaagagcatcccccgcaggaattatgg
cgtgaggattggactcatggcgacatgatgctcgcggagcagttcatcgccgggcgcgaa
ctcacatgcgcggtcatgaacgacaaggctctcgacgtgatcgaaattctcgctgccgac
ggcggctggtacgattatcacgcgaaatacgccaagggcggctcgaaacacgtccttccg
gcaaatcttaaacagaatatttaccaagaggtccaacatttggcccttgaggctcaccga
gctctcggctgtcgcggcgtaagccgcgcggacttccgatacgacgaccgccccggaggt
acgggcgagctcgtcgtattggaagtgaacacgcagccgggaatgacggagacctcgctc
gtgccagaaatggcggcatacgcaggtttttcattcggcgagttggtcagatggatggtg
gaagacgcatcctgcgatcgttga

DBGET integrated database retrieval system