KEGG   Methylocystis rosea: EHO51_09370
Entry
EHO51_09370       CDS       T05721                                 

Gene name
murB
Definition
(GenBank) UDP-N-acetylmuramate dehydrogenase
  KO
K00075  UDP-N-acetylmuramate dehydrogenase [EC:1.3.1.98]
Organism
mros  Methylocystis rosea
Pathway
mros00520  Amino sugar and nucleotide sugar metabolism
mros00550  Peptidoglycan biosynthesis
mros01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mros00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    EHO51_09370 (murB)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EHO51_09370 (murB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mros01011]
    EHO51_09370 (murB)
Enzymes [BR:mros01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.98  UDP-N-acetylmuramate dehydrogenase
     EHO51_09370 (murB)
Peptidoglycan biosynthesis and degradation proteins [BR:mros01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   EHO51_09370 (murB)
SSDB
Motif
Pfam: MurB_C FAD_binding_4
Other DBs
NCBI-ProteinID: AZG76924
UniProt: A0A3G8M5R2
LinkDB
Position
complement(1925563..1926483)
AA seq 306 aa
MTFPDISADITATMPQLRGRITANEPLAPYTWFRVGGPAQILFMPADEADLAYFLARLPR
EIPVSVVGLGSNLIVRDGGVEGVVIRLSAKGFGEIVVEDGCRLRVGAAVPDVKAARAAAE
AGVDGLAFYRGIPGAIGGALRMNAGAHGGETKDALIEARGVDRAGDVRVFGVADMGYSYR
HCSAPDDVIFTQALYQGRPGDPATIIAEMDRITAAREASQPIKEKTGGSTFKNPDGRKAW
QLIDAAGCRGLVVGDAQVSEMHCNFLINRGRASAADIEALGEEVRRRVRETSGVELHWEI
KRIGVA
NT seq 921 nt   +upstreamnt  +downstreamnt
atgaccttccccgatatctccgctgatataacggccacgatgccgcaattgcgcgggcgc
atcacggcgaatgagccgctcgcgccttacacatggttccgcgtcggcgggccggcgcag
atcctgttcatgccggccgacgaagccgatctcgcctatttcctcgcgcgattgccgcga
gagattcccgtatccgtcgtcggccttggctccaatctgatcgtgcgcgacggcggcgtc
gaaggcgtggtcatacgcctgtcggccaagggttttggcgagatcgtcgtcgaggacggc
tgcaggctgcgcgtcggcgccgcggtccccgacgtgaaggccgcgcgcgcggccgccgaa
gcgggcgttgacggactcgccttctatcgcggcattcccggcgcgatcggcggcgcgttg
cgcatgaacgccggcgcgcatggcggcgagaccaaggacgcgctgattgaagcgcgcggc
gtcgaccgcgccggcgacgtccgcgtctttggcgtcgccgacatgggctattcctatcgc
cattgttccgcccccgacgatgtgatcttcacgcaggcgctttaccagggacgtcccggc
gatccggcgacgatcatcgccgagatggatcgcatcaccgcggcgcgtgaggcctcgcag
ccgatcaaggaaaagaccggcggctcgactttcaagaatcctgacggccgcaaggcatgg
caattgattgatgcggccggctgtcgcggactcgtcgtcggcgatgcgcaggtgagcgaa
atgcattgcaattttctcatcaatcgggggcgtgcgagcgccgccgacatcgaggcgctt
ggcgaagaggtgcgccggcgcgtgcgcgaaacgagcggcgtcgaactacattgggaaatc
aagcgtataggcgtcgcttga

DBGET integrated database retrieval system