KEGG   Methylocystis rosea: EHO51_09385
Entry
EHO51_09385       CDS       T05721                                 

Definition
(GenBank) UDP-N-acetylmuramate--L-alanine ligase
  KO
K01924  UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
Organism
mros  Methylocystis rosea
Pathway
mros00471  D-Glutamine and D-glutamate metabolism
mros00550  Peptidoglycan biosynthesis
mros01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mros00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    EHO51_09385
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EHO51_09385
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mros01011]
    EHO51_09385
Enzymes [BR:mros01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.8  UDP-N-acetylmuramate---L-alanine ligase
     EHO51_09385
Peptidoglycan biosynthesis and degradation proteins [BR:mros01011]
 Precursor biosynthesis
  Amino acid ligase
   EHO51_09385
SSDB
Motif
Pfam: Mur_ligase Mur_ligase_M Mur_ligase_C ABC_sub_bind
Other DBs
NCBI-ProteinID: AZG76927
UniProt: A0A3G8M5B1
LinkDB
Position
complement(1927459..1928865)
AA seq 468 aa
MKLPKELGPIHFVGIGGIGMSGIAEVLLNLGYKVQGSDAAENANVKRLVEKGATISIGHD
AKNLGEAAVVVVSTAIKRDNPELVLAREKRLPVVRRAEMLAELMRLKQCVAIAGTHGKTT
TTSLVATLLDAGGLDPTVINGGIINAYGTNARLGAGDWMVVEADESDGTFLKLPADVAIV
TNIDPEHLDHFHTFDAIKEAFRNFVENIPFYGFAVMCLDHPTVQELVGRIEDRRVITYGE
NPQADVRLLDVDLEGGVSKFNVLLRDRKTSQAIYLENLVLPMPGHHNALNATAAIAVANQ
LGLSPEQIRKALAGFGGVKRRFTKTGEWNGVQIFDDYGHHPVEIAAVLRAARASTKGKVV
ALMQPHRYSRLQSLFDAFATCFNDADVVIIADVYPAGEQPIPGADRDALVSAIKAHGHRR
AMGLPSPEVLAAMVREIVAPGDYVVCLGAGNITQWAYALPEQLAAGQG
NT seq 1407 nt   +upstreamnt  +downstreamnt
atgaaactgccgaaagagttgggcccgattcacttcgtcggcatcggcggcatcggcatg
tctggaatcgccgaagtgctgctcaatctcggctacaaggtgcagggatctgacgcggcc
gagaacgccaacgtcaagcgtctcgtcgaaaagggcgcgacgatcagcatcggacatgac
gcgaaaaacctcggcgaagccgcagtggtcgtcgtctccaccgcgatcaagcgcgacaat
cccgaacttgtcttggcgcgcgaaaaacgtctgccggtcgtgcgtcgcgccgaaatgctg
gccgagttgatgcgcctcaagcaatgcgtcgccatcgccggcacgcatggcaagacgacg
acgacctcgctcgttgcgacgctgctcgacgccggcggcctcgatccgaccgtgatcaac
ggcggcatcatcaacgcctatggcacgaatgcgcgtcttggcgccggcgactggatggtg
gtggaggccgacgaaagcgacggcacgtttctcaaactgccggcggacgtcgccatcgtc
accaatatcgatcccgaacatctcgaccatttccatacattcgacgccatcaaggaagcc
ttccgcaacttcgtcgagaatattcccttctacggcttcgcggtgatgtgcctcgatcat
ccgaccgtgcaggagctcgtcggccgcatcgaggaccgccgcgtcatcacctatggcgaa
aatccgcaggccgacgtgcgtctgctcgacgtcgatctcgagggcggcgtgtcgaagttc
aatgtgctgctgcgcgaccgcaagacgtcgcaggcgatctatctcgaaaatctcgtcctg
ccgatgccgggccatcacaatgcgttgaacgcgacggcggcgatcgccgtcgccaatcag
ctcggcctgtcgcccgaacaaatccgcaaggcgcttgccggctttggcggcgtgaagcgg
cgcttcaccaagacgggcgaatggaacggcgtgcagattttcgacgactatggacatcat
cccgtcgaaatcgccgccgtgctgcgcgcggcgcgcgcctccaccaagggcaaggtcgtc
gcgctgatgcagccgcatcgctattcgcggctgcagtcgcttttcgatgctttcgccacc
tgtttcaacgacgcggacgtggtcatcatcgccgacgtctatccggcgggcgaacagccg
attccgggcgctgatcgcgatgcgctcgtgtccgccatcaaggcgcatggccatcgccgc
gcgatggggctgccctctcccgaagtgctggcggcgatggttcgcgagatcgtcgcgccg
ggcgattatgtcgtgtgtcttggcgccggcaatatcacgcaatgggcctatgcgctgccg
gagcagctcgcggcggggcaggggtga

DBGET integrated database retrieval system