KEGG   Methylocystis rosea: EHO51_09390
Entry
EHO51_09390       CDS       T05721                                 

Gene name
murG
Definition
(GenBank) undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase
  KO
K02563  UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [EC:2.4.1.227]
Organism
mros  Methylocystis rosea
Pathway
mros00550  Peptidoglycan biosynthesis
mros01100  Metabolic pathways
mros01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mros00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EHO51_09390 (murG)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    EHO51_09390 (murG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mros01011]
    EHO51_09390 (murG)
Enzymes [BR:mros01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.227  undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase
     EHO51_09390 (murG)
Peptidoglycan biosynthesis and degradation proteins [BR:mros01011]
 Precursor biosynthesis
  Glycosyltransferase
   EHO51_09390 (murG)
SSDB
Motif
Pfam: Glyco_tran_28_C Glyco_transf_28 Glyco_trans_1_3 UDPGT
Other DBs
NCBI-ProteinID: AZG76928
UniProt: A0A3G8M802
LinkDB
Position
complement(1928867..1929976)
AA seq 369 aa
MIDSPILLAAGGTGGHLFPAEALAHALAARGLAVELVTEERALRYGGAFPARALHVIPAG
TPRGGSLLAKAQAVARLALGTAQAVALLRQVKPAAVIGFGGYPTVPPLLAASYIGVPSAL
HEANGVMGKANRFLAGRVDRIAAGLPTLAVPAALQSKVVVTGNPVRPNVLEAAKTPYPSF
DDGMFRLLVAGGSQGARVMADIAPAAVAALPDALRAKISVVQQARPEDIARVEAIYAGAG
VDAEIAPFFADFPARLAAAHFVITRAGASTVSELAVVGRPAMLVPLPHALDQDQAANAAF
LEAAGGAETVRQSDFTPEFLTRRLCELINAPAQLATRAEAAKSVGVADAADRLADLIIDV
ARTGATKRS
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgatcgattcgccgattctcctcgccgccggcggcaccggcggccatctttttccggcc
gaggcgcttgcgcatgcgctcgccgcccgcgggctggcggtggagctcgtcaccgaggag
cgcgccctgcgctacggcggcgcctttccggcgcgagccctgcatgtgattcctgccggc
acgccgcggggcggctcgctgctcgccaaggctcaggcggtcgcgcgtcttgcccttgga
actgcgcaggctgtcgcgctgctgcgccaggtcaagccggccgcggtgatcggtttcggc
ggctacccgaccgttccgcccttgcttgcggcgtcctatatcggcgtgccgagcgctttg
catgaagcgaatggcgtcatgggcaaggccaatcgcttcctcgccggccgcgtcgacagg
atcgccgccggcctgccgactctggccgtgcccgcagccttgcaaagcaaggtcgtcgtc
accggcaatcccgtgcgtcccaatgtgctcgaggccgccaagactccctatccttcgttc
gacgatggaatgttccggctgctcgtcgccggcggctctcagggcgcccgcgttatggcg
gacatcgcgccggcggccgtcgcggcgctccccgacgcgctgcgggcgaaaatttctgtc
gttcaacaggcgcgtcccgaagatatcgcgcgggtcgaggcgatctacgccggcgctggg
gtcgacgccgagattgcgccctttttcgccgacttcccggcgcggctcgctgcggcgcat
ttcgtcatcacccgcgccggcgcgtcgacggtctcggagctcgcggtcgtcgggcgaccg
gcgatgctggtgccgttgccgcatgcgctcgaccaggaccaggcggcgaacgcggctttt
ctcgaagcggcgggcggcgccgaaaccgtgcgccagagcgacttcacgccggagtttttg
acgcggcggctttgtgaactcatcaatgcgccggcgcaactcgcgacgcgcgccgaagcc
gcaaagagcgtcggcgtcgccgacgccgccgatcgtctcgccgatctgatcatcgacgtg
gcgcggacaggcgctacgaaacggagctag

DBGET integrated database retrieval system