KEGG   Methylocystis rosea: EHO51_09405
Entry
EHO51_09405       CDS       T05721                                 

Definition
(GenBank) phospho-N-acetylmuramoyl-pentapeptide-transferase
  KO
K01000  phospho-N-acetylmuramoyl-pentapeptide-transferase [EC:2.7.8.13]
Organism
mros  Methylocystis rosea
Pathway
mros00550  Peptidoglycan biosynthesis
mros01100  Metabolic pathways
mros01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mros00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EHO51_09405
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    EHO51_09405
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mros01011]
    EHO51_09405
Enzymes [BR:mros01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.13  phospho-N-acetylmuramoyl-pentapeptide-transferase
     EHO51_09405
Peptidoglycan biosynthesis and degradation proteins [BR:mros01011]
 Precursor biosynthesis
  Glycosyltransferase
   EHO51_09405
SSDB
Motif
Pfam: Glycos_transf_4 MraY_sig1
Other DBs
NCBI-ProteinID: AZG76931
UniProt: A0A3G8M4S8
LinkDB
Position
complement(1932571..1933653)
AA seq 360 aa
MLTLLADFSYLYSPLNVFRYITFRAAMGAATALFFVFFFGPGVIAALRIKQGKGQPIRED
GPASHLVTKKGTPTMGGLMILSGLVAATLLWANLRNAYVWIVLFVTVSFGLIGFYDDYLK
VTKQSHAGFSGKMRLALEFMIAGLACYALMETGGDNMTKLAIPMVRGYVATLGPLFILFG
AFVIVAAGNCVNLTDGLDGLAIVPSMIAAGAFAIFAYLVGNSIFSNYLGVNYVAGVGELT
IVCSAFIGAGLGFLWFNAPPAQIFMGDTGSLALGGLVGSVAVAVKQEFVLVIVGGLFVIE
GASVIIQVVYYKLTGKRIFLMAPIHHHFEQKGWKEPQIVIRFWIIAFVLALMGLSTLKLR
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgctaaccctgcttgcggacttctcttatctttacagtccgctaaacgtcttccgttac
atcacttttcgcgccgccatgggggcggcgacggcgctgttctttgtgtttttcttcggt
ccgggcgtgatcgccgcgttgcgcatcaagcagggcaagggccagccgatccgcgaggac
ggaccggcttcgcatctcgtgaccaaaaaaggcacgccgacgatgggcggcctgatgatc
ctctcgggactcgtcgcggcgacgctgctctgggcgaatttgcgcaacgcctatgtgtgg
atcgtgctctttgtcaccgtcagcttcggcctcatcggcttttatgacgactatctcaag
gtgaccaagcagtcgcacgccggcttctcgggcaagatgcgattggcgcttgagtttatg
attgccggcctggcctgctacgcgctgatggaaaccggcggcgacaacatgacgaagctc
gccatccccatggtgcggggctatgtcgcgacgctgggtccgctcttcatcctgtttggc
gccttcgtcatcgtcgccgcgggcaattgcgtcaatcttaccgatggactcgacgggctc
gccatcgtgccgtcgatgatcgccgccggcgcctttgcgatcttcgcctatctcgtcggc
aattcgatcttttcgaattatcttggcgtgaattacgtggccggcgttggcgaattgacg
atcgtctgctcggccttcatcggcgcagggctcggctttttgtggttcaacgcgccgccc
gcacaaatcttcatgggcgacaccggctctctggcgctcggcgggctcgtcggctccgtg
gcggtggcggtgaagcaggagttcgtgctcgtcatcgtcggcggcctttttgttatcgaa
ggcgcgtcagtcatcatccaggtcgtctattacaagctgaccggcaagcgcatcttcctg
atggcgccgatccatcaccacttcgaacagaaggggtggaaggagccgcagatcgtcatc
cgcttctggatcatcgccttcgtcctggccctgatgggcctctcgaccttgaagctgagg
tga

DBGET integrated database retrieval system