KEGG   Methylocystis rosea: EHO51_09410
Entry
EHO51_09410       CDS       T05721                                 

Definition
(GenBank) UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate--D-alanyl-D-alanine ligase
  KO
K01929  UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase [EC:6.3.2.10]
Organism
mros  Methylocystis rosea
Pathway
mros00300  Lysine biosynthesis
mros00550  Peptidoglycan biosynthesis
mros01100  Metabolic pathways
mros01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mros00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    EHO51_09410
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EHO51_09410
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    EHO51_09410
Enzymes [BR:mros01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.10  UDP-N-acetylmuramoyl-tripeptide---D-alanyl-D-alanine ligase
     EHO51_09410
SSDB
Motif
Pfam: Mur_ligase_M Mur_ligase_C Mur_ligase
Other DBs
NCBI-ProteinID: AZG76932
UniProt: A0A3G8M6W2
LinkDB
Position
complement(1933663..1935081)
AA seq 472 aa
MTKRPLWSGLALVGALRARASGGLAREAAGVSIDTRTLQPGDLFIAIKGETRDGHDFVRM
AFEKGAAAAVIDEAHATELSGAGPLFVVRDVQQSLESLGARARERSAAFIAAVTGSVGKT
STKDMVRLMLSRFGDTHASAASYNNHWGVPLTLARMPAESRFGVFELGMNHAGEIAALVA
QVRPHVAVVTRIAPVHLEYFGSIEKIADAKAEIFSALDGGVAIINRDDGFYERLAAAAAP
TASHVFGFGETEGAHARLLSYEPADEGALVEAEILERRLRFRIGAPGKHIAMNALAALLV
GVVFDVDLEEAAAAFSEFTPPSGRGQREKIVTPDGAFTLIDESYNANPTSMRAALQLLGG
AATGPGGRRIAVLGDMLELGPQAAELHAELAQDLIGAKVDLLFTSGPLMSRLSYAVPDSM
RAAHRATPLELEEAVLAAVRPGDVVMVKGSNGSRMARIVSALKSVFAPEMAN
NT seq 1419 nt   +upstreamnt  +downstreamnt
atgaccaagaggccgttatggtcgggattggcgctggtgggcgcgctgcgcgcgcgtgcg
agcggcggccttgcgcgcgaagccgccggcgtttccatcgatacccgcacccttcagccc
ggcgatctgtttatcgcgatcaagggcgagacgcgcgatggtcacgacttcgtgcggatg
gcgtttgagaaaggcgcggcggccgcggtcatcgacgaagcgcatgcgactgagctttct
ggcgccggaccgcttttcgtcgtcagagacgtgcagcagtcgctcgagtcgctgggcgcg
cgggcgcgcgagcgaagcgccgcctttatcgccgccgtcaccggctccgtcggcaagacc
tcgacgaaggacatggtccggctgatgctgtcgcggttcggcgatacgcatgcctcggcg
gcgtcttacaacaatcactggggcgtgccgttgacgctcgcccgaatgccggcggagtcg
cgctttggcgtgttcgaactcggcatgaatcacgcgggcgagatcgccgcgctcgtcgct
caggtgcgcccccacgtcgccgtcgtgacccgcatcgcgccggttcatctcgaatatttc
ggatcaatcgagaagattgcggacgccaaggccgaaatcttttccgcgctcgacggcggc
gtcgcgatcatcaaccgcgacgatggattttacgagcgtctcgccgcggcggccgcgccg
accgccagccatgtctttgggttcggggagacggaaggcgcgcatgcgcggctcctgtct
tacgagcccgccgacgaaggcgcgctggtcgaggcggaaattctcgagcggcgactacgc
tttcgcatcggcgccccaggcaagcatatcgccatgaacgcgctcgcggcgctgctcgtg
ggcgtcgttttcgacgtggatttggaggaagctgcggcggccttcagcgaattcacgcct
ccctccggacgtggacagcgcgagaaaatcgtgacgccagacggcgcgtttacgcttatc
gacgaaagctacaacgccaacccgacctctatgcgggcagcgctgcagctgctcggcggc
gcggcgacaggacctggaggccggcgcatcgccgtgctcggcgacatgctggagctcggg
ccgcaggcggccgaactgcatgccgaactcgctcaggacctcattggcgcgaaagtcgac
ctgctattcacctcggggccattgatgtcacgcttgagttacgctgtgcctgattcgatg
cgcgcggcgcatcgggcgacgccgctggagctggaagaggccgttctcgcagcggttcgt
cccggcgatgtggtgatggtgaaaggctccaatggttcgcggatggcgcggatcgtctcg
gccttgaaaagcgtattcgcccccgaaatggcgaactga

DBGET integrated database retrieval system