KEGG   Methylocystis rosea: EHO51_09415
Entry
EHO51_09415       CDS       T05721                                 

Definition
(GenBank) UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase
  KO
K01928  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
mros  Methylocystis rosea
Pathway
mros00300  Lysine biosynthesis
mros00550  Peptidoglycan biosynthesis
mros01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mros00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    EHO51_09415
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EHO51_09415
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mros01011]
    EHO51_09415
Enzymes [BR:mros01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     EHO51_09415
Peptidoglycan biosynthesis and degradation proteins [BR:mros01011]
 Precursor biosynthesis
  Amino acid ligase
   EHO51_09415
SSDB
Motif
Pfam: Mur_ligase_M Mur_ligase_C Mur_ligase
Other DBs
NCBI-ProteinID: AZG76933
UniProt: A0A3G8M4P9
LinkDB
Position
complement(1935078..1936529)
AA seq 483 aa
MLLSELLATPDLEPALHGLAVSGLTADSRMARSGFAFFAIPGHAGDGMSYVADAKSRGAC
VVVAQRRADSPLPLVVVDDVRRALALAAARFFSRQPSTIAAVTGTSGKTSVVAFLRQIWA
ALGHEAASLGTVGIVDSRGAHYGALTTPGPVELHRTLDELAGRGVTHLAMEASSLGIDQR
RLDGMRVDVAGFTNFSRDHLDHHADMEDYFAAKMRLFDTLLHPGQTAVIDADSDVASRVV
EICRVRGLTISSVGSKGETIRLLSATPSALATSLRLRHNGADYEVNLPLAGAFQVSNALV
AAGLAIASGDDPGRVFAALEALKGAPGRLELVGQRNGAPIFVDYAHKPDALEKVLATLRP
LTKKRLIVVFGCGGDRDRGKRPLMGDIVARAADVAIVTDDNPRSEDAAAIRAEILEGTRS
GAAHIIEIGDRRAAIANAVAGLEAGDALVVAGKGHETGQIIGDRVLPFSDHEAIAQALKE
NHP
NT seq 1452 nt   +upstreamnt  +downstreamnt
atgctgctttcggaactgcttgcgacgccagaccttgagcccgccttgcacgggcttgcc
gtctccggcctgacggctgacagtcgaatggcgcgcagcggcttcgcctttttcgccatc
ccgggccacgccggcgacggcatgtcctatgtcgccgacgctaagtcgcgcggcgcctgc
gtcgtcgtcgcgcagcggagagctgacagcccgctgccgcttgtcgtcgtcgatgacgtt
cggcgcgccctggccctcgccgcggcgcggttcttttctcgtcagccgtcgacgatcgcg
gcggttacgggaacgagcggcaagacgtcagtggtggccttcttgcgccagatctgggcc
gcgcttggacatgaggcggcgtcgctcggcaccgtcgggattgtcgattctcgcggcgcg
cattatggagcgctgacgacgcccggacccgtcgaactgcacagaacgctggacgaactt
gccggacgcggcgtgacgcatctcgccatggaggcgtcatcgctggggatcgatcagcgg
cggctcgacggcatgcgcgtcgacgtcgcgggcttcaccaatttctcgcgcgaccatctc
gaccatcacgccgacatggaggactatttcgcggcgaagatgcggctcttcgacacgctg
ctgcaccctggccagacggcggtgatcgacgccgacagcgacgttgcttcccgcgtcgtc
gaaatctgccgcgtgaggggactcacaatttcgagcgtcggttcgaagggcgagacgata
aggctcctttcggcgacgccgtccgccttagcaacgtcgctgcggctccgccataatggc
gccgactatgaggtcaatctgccgcttgccggcgccttccaggtctcgaacgcgctcgtc
gccgcggggctggccatcgcaagcggcgatgatccggggcgagtctttgcggcgctcgaa
gcgctcaagggcgcgccggggcggctcgaactcgtcggtcagcgtaacggcgcgccgatt
ttcgtagattacgcgcataagcctgacgcgctggagaaagtgctcgccactttacggccg
ctgacaaaaaaacgcctgattgtcgtcttcgggtgcggcggcgatcgtgatcgtggcaag
cgcccgctgatgggggacatcgtcgcccgcgcggcggatgtcgccatcgtcacggacgac
aatccgcgcagcgaggacgccgccgccattcgcgcagaaattctcgaaggaacccgcagc
ggcgcggcgcacatcatcgagatcggagaccggcgcgcggcgatcgccaacgccgtcgcg
gggcttgaagcgggcgatgcgctcgtcgtggctggaaagggccacgaaaccgggcagatc
atcggcgaccgcgttttgcctttctccgatcatgaggcgattgcgcaggcgctcaaggag
aatcatccatga

DBGET integrated database retrieval system