KEGG   Methylocystis rosea: EHO51_09420
Entry
EHO51_09420       CDS       T05721                                 

Definition
(GenBank) penicillin-binding protein 2
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
mros  Methylocystis rosea
Pathway
mros00550  Peptidoglycan biosynthesis
mros01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:mros00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EHO51_09420
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    EHO51_09420
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mros01011]
    EHO51_09420
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mros03036]
    EHO51_09420
Enzymes [BR:mros01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     EHO51_09420
Peptidoglycan biosynthesis and degradation proteins [BR:mros01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   EHO51_09420
Chromosome and associated proteins [BR:mros03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    EHO51_09420
SSDB
Motif
Pfam: Transpeptidase PBP_dimer Beta-lactamase
Other DBs
NCBI-ProteinID: AZG76934
UniProt: A0A3G8M5S2
LinkDB
Position
complement(1936529..1938304)
AA seq 591 aa
MTQTMLDTQPSPPPVGKIRAMLRALFSTSLALSASRMRLAALAFLALYAVISIKLVYLAF
KPEAATSRRAAAEAVAASRPDIIDRNGEALASDVKVMSVFAEPRRIIDKDEATELLTAVL
PGLDARDLRERLGSKKGFVWVKREVTTHQRDEVFHLGLPGVGLIAENKRVYPNGPIGAHV
LGFANVDNQGIAGIEKYIDGQGLADLHGAGFGVTPEELKPVSLSLDIRVTHALRDELEKG
VTHFKAKAGAAAILDVNTGEVIALASLPDYDPNKPTEALDPIHINRMSVGVYEMGSTFKA
LTIAMALDSGKVNLNSRLDARGVLSFGRFKIHDYHAQNRALTLPEVFTYSSNVGTARMAM
GQGVERHKAFLRKMGQLTRMRTELPESAEPIVPKNWGELNTMTIAFGHGLAVAPLQAMMA
VGALMNGGYLITPTFIKRSEEEAKAGAERVVRPETSEAMRYLMRLNAEIGTARKVNVPGY
FVGGKTGTAEKVVNGHYSKNRLFNTFMAVAPSDKPKYLFLTIMDEPQGLPETGGYATAAY
NAGHVTGEIIERVGPILGLAPRFEPPHQPFPLLAKLGYGYANVPARGGGGH
NT seq 1776 nt   +upstreamnt  +downstreamnt
atgacgcagacaatgctcgacacgcaaccttcgccgccgccggttggcaaaatacgcgcg
atgctgcgcgcgctgttttcgacgagtctcgcgctgagcgcgtcgcgcatgcggctcgcg
gcgctggcctttctcgcgctctacgcggtgatttcgatcaagctcgtctatctcgcattc
aagccggaggcggcgacgtcgcggcgcgccgcagcggaggcggtcgcggcgtcccgtccg
gacattatcgatcgcaacggcgaggcgcttgcaagcgacgtcaaggtgatgtcggtgttc
gccgagccgcgccgcatcatcgacaaggacgaagcgaccgagctcttgaccgcggttttg
cctggcctcgacgcccgcgatttgcgcgagcggctcggctccaagaaaggcttcgtttgg
gtgaagcgcgaggtgacgacgcatcagcgcgacgaagtcttccatctcggactgccgggc
gtcggactgatcgccgaaaataagcgcgtttatcccaatggaccgatcggcgcgcatgtg
ctcggcttcgccaatgtggacaatcagggcatcgctggcatcgagaaatacatcgacggg
cagggcctcgccgatttgcacggcgccggcttcggcgtgacgccagaggaactcaagccc
gtgtcgctttcgctcgacattcgggtcacgcatgcgttgcgcgacgaactcgaaaagggc
gtaacccactttaaggcgaaggcgggcgccgcggcgatcttggacgtcaacaccggagag
gtcatcgcgctcgcgtcgcttcccgactacgatccgaacaagccgacggaagcgctcgat
cctatccacatcaaccgcatgagcgtcggcgtttatgagatgggctccaccttcaaggcg
ctgaccatcgcgatggcgctcgactcgggcaaggtcaatctgaattcacggcttgacgcg
cgcggcgtgctctcgttcgggcgcttcaaaatccatgactatcacgcgcaaaatcgcgcg
ctcacactgccagaggtcttcacctattcctccaatgtcggcaccgcgcgcatggcgatg
gggcagggcgtggagcggcacaaggcgtttttgcgcaagatgggccagctcacgcgcatg
cgcactgaactgccggaaagcgcggaacccatcgtgccgaaaaattggggcgagttgaac
accatgaccatcgctttcggtcatggccttgcggtggcgccgctccaggcgatgatggcc
gtcggcgcgctgatgaatggcggctatctgatcacgccgaccttcatcaagcgcagcgag
gaggaagcgaaggcgggcgccgaacgcgtcgtgaggccggagacgagtgaggcgatgcgc
tatctcatgcgtctcaacgccgaaatcggcacggcgcggaaggtgaacgtccccggctat
ttcgtcggcggcaaaaccggcaccgcggaaaaggtcgttaacggccattattcgaagaac
cggctgtttaacactttcatggccgtcgcgccgtccgacaagccgaaatatctgttcctg
accatcatggacgaaccgcagggcttgccggaaaccggcggctacgcgacggcggcctat
aacgcgggacatgtcacgggcgagatcatcgagcgcgtcggtccgattctcggccttgcg
ccgcgtttcgagccgccgcaccagcctttcccgctcctcgccaaattaggttatggctat
gccaatgttccggcccgcggcggcggaggacattga

DBGET integrated database retrieval system