KEGG   Methylocystis rosea: EHO51_11610
Entry
EHO51_11610       CDS       T05721                                 

Gene name
murA
Definition
(GenBank) UDP-N-acetylglucosamine 1-carboxyvinyltransferase
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
mros  Methylocystis rosea
Pathway
mros00520  Amino sugar and nucleotide sugar metabolism
mros00550  Peptidoglycan biosynthesis
mros01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mros00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    EHO51_11610 (murA)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EHO51_11610 (murA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mros01011]
    EHO51_11610 (murA)
Enzymes [BR:mros01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     EHO51_11610 (murA)
Peptidoglycan biosynthesis and degradation proteins [BR:mros01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   EHO51_11610 (murA)
SSDB
Motif
Pfam: EPSP_synthase
Other DBs
NCBI-ProteinID: AZG77328
UniProt: A0A3G8M942
LinkDB
Position
complement(2406814..2408109)
AA seq 431 aa
MDKIKIVGGTRLNGVIPISGAKNAALPLMIASLLTRETVTLANMPLLADVMLLERILGNH
GVDYAIAGKRTGESVDAGRTVHLTAREIVDTTAPYDLVSRMRASFWVLAPLVARCGEARV
SLPGGCAIGTRPVDLLLMALEKLGAKLDIENGYVVASAKNGLIGAEIDFPKVTVGGTHTA
LMAASLARGTTVLRNAAREPEVVDLADCLIKMGARIKGAGQSTIEIEGVGSLFGARHAVM
PDRIEAGTYAMAVAMTGGDVLLAGARADLLQAGLDALVQAGASITETNEGLRVTRNGAGI
SPVDVTTAPFPAFPTDLQAQFMALMTRAKGVSRITETIFENRFMHVQELARLGAQIKLEG
DTAIVTGADHLDGAPVMATDLRASVSLVIAALAARGETTINRVYHLDRGFERLEKKLRDC
GAEIERITAAG
NT seq 1296 nt   +upstreamnt  +downstreamnt
atggataagatcaagatcgtcggcgggaccaggctcaatggcgtgatcccgatttccggc
gcgaagaacgccgccttgccgttgatgatcgcatcgctcctgacgcgcgaaaccgtgacg
ctcgccaacatgccgctcctcgcggatgtgatgcttcttgagcgcattctcggcaatcat
ggcgtggattacgccatcgccggcaagcgcaccggcgagtccgtcgacgccggccgcacc
gttcatctcaccgcgcgtgaaatcgtcgacaccaccgcgccctatgatctcgtctcgcgc
atgcgcgccagcttctgggtgctcgcgccgctcgtcgcgcgttgcggcgaggcgcgcgtg
tcgctgccgggcggctgcgcgattggcacccgccctgtcgatcttctgctcatggcgctg
gaaaagctcggcgccaaactcgacatcgaaaatggttacgtcgtcgcctcggcgaagaat
ggtctcatcggcgccgagatcgactttcccaaagtcaccgtcggcggcacgcatacggcg
ctgatggcggcgtcgctcgcgcgcgggaccaccgtgctgcgcaacgccgcgcgcgaaccc
gaagtcgtcgatcttgccgactgcctcataaaaatgggcgcgcgcatcaagggcgccggc
cagtcgacgatcgagatcgagggcgtgggttcgcttttcggggcaagacacgcggtcatg
cccgatcgcatcgaggcgggcacttacgccatggcggtggcgatgacggggggcgacgtt
ctgctcgccggcgcgcgcgccgatcttctgcaggcggggctcgacgctctcgtgcaggca
ggcgccagcatcaccgagacgaatgaaggactgcgggtgacgcgtaacggcgccggcatt
tcgccggtcgacgtcacgacggcgcccttccccgccttcccgaccgatctgcaggcgcag
ttcatggcgctgatgacgcgcgccaagggcgtttcgcgcatcaccgagacgattttcgag
aaccgcttcatgcatgtgcaggagctcgcgcggctcggcgctcaaatcaagcttgaaggg
gatacggcgatcgtgacgggggccgatcacctcgatggcgcgccggtgatggcgacggat
ctgcgcgcctcagtctcgctcgtcatcgcggcgctcgccgcgcgcggcgagacgacgatc
aaccgagtctatcatctcgatcgcggtttcgagcgcctggagaagaagctgcgcgactgc
ggcgcggaaatcgagcgcatcaccgcggcggggtga

DBGET integrated database retrieval system