KEGG   Methylocystis rosea: EHO51_15285Help
Entry
EHO51_15285       CDS       T05721                                 

Gene name
odhB
Definition
(GenBank) 2-oxoglutarate dehydrogenase complex dihydrolipoyllysine-residue succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mros  Methylocystis rosea
Pathway
mros00020  Citrate cycle (TCA cycle)
mros00310  Lysine degradation
mros00380  Tryptophan metabolism
mros01100  Metabolic pathways
mros01110  Biosynthesis of secondary metabolites
mros01120  Microbial metabolism in diverse environments
mros01130  Biosynthesis of antibiotics
mros01200  Carbon metabolism
Module
mros_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mros_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mros00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EHO51_15285 (odhB)
  09105 Amino acid metabolism
   00310 Lysine degradation
    EHO51_15285 (odhB)
   00380 Tryptophan metabolism
    EHO51_15285 (odhB)
Enzymes [BR:mros01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     EHO51_15285 (odhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding HlyD_D23 HlyD_3 GCV_H
Motif
Other DBs
NCBI-ProteinID: AZG77989
UniProt: A0A3G8M7M1
LinkDB All DBs
Position
complement(3148469..3149770)
Genome map
AA seq 433 aa AA seqDB search
MAEIRVPTLGESVTEATIGRWFKKAGDAVRADEALAELETDKVTLEVNAPAAGVLAEIVA
KEGETVGPGALLGQIAEGAAAPAKAGETAGKSPAPKPAPAPAAPAPKSAPAPAPAAPAPA
ATQMPPAPSAAKIAVEQGIDVAQVPGSGKRGQALKSDVVQFAARQAAAPQPAQEGRVQEL
PAQEARVEAPPPRVPVPQEDARHEERVKMTRLRQTIARRLKEAQNTAAILTTFNEVDMSA
LIELRKRYKEAFEKRHGVKLGFMGFFVKACCQALEEIPAVNAEIDGTDIIYKRFCHIGVA
VGTEKGLVVPVVRDTDRLSLADIEKTIAELGRKAREGSLDISDLQGGTFTISNGGVYGSL
MSTPILNAPQSGILGMHKIQERPVVVDGKIEARPMMYLALSYDHRVVDGKEAVTFLVRVK
ELLEDPARLALGL
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaatacgcgtgccgaccttgggcgaatcggtgactgaagcgacgatcggccgc
tggttcaagaaggcgggcgacgcggtgcgcgccgacgaggcgctcgccgagctcgagacc
gacaaagtcacgctcgaagtcaacgcccccgcagccggcgtgctcgccgagatcgtcgcc
aaggagggcgaaactgtcggtcctggcgcgctgctcggacagatcgccgagggcgccgcg
gcgccggcgaaggcaggcgagaccgccggcaaaagccccgcgcctaaaccggcgccagcc
cccgcagcgcctgcgcccaaatccgctccggctccggcgccggcagcgcccgcgcccgcc
gcgacccagatgccgcccgcgccgtcagccgccaagatcgccgtcgagcaagggatcgac
gttgctcaggttcccggcagcggcaagcgcggccaggcgctgaaatcggacgtcgttcaa
ttcgccgcgcgtcaggcggctgcgccgcagcccgcgcaagaaggccgcgtccaggagctt
cccgcccaggaagcgcgagtcgaggcgccgccgccccgcgtcccagttccgcaggaagac
gcacgccacgaagagcgggttaaaatgacgcgcttgcgtcagacgatcgcgcgccggctg
aaagaagcgcaaaacaccgccgccattctgacgacgttcaacgaagtcgacatgtcggcg
ctcatcgaattgcgcaaacgctacaaggaggcgttcgagaagcggcacggcgtgaagctg
ggcttcatgggcttcttcgtgaaggcctgttgccaggcgctggaagagatccccgccgtc
aatgcggagatcgacgggacggatatcatctacaagcgcttctgccatatcggagtcgcc
gtcggcacggagaagggactcgtcgtgccggtggtgcgcgacaccgaccgtctatcgctc
gccgatatcgaaaaaaccatcgccgaacttggccgcaaagcgcgcgagggctcgctcgac
atctccgatctgcagggtggcacgttcacgatttccaacggcggcgtctatggttcgctg
atgtccacgccgatcctgaatgcgccgcaatcgggcattctcggcatgcacaagattcag
gaacgccctgtggtcgttgacggcaagatcgaagcgcggccgatgatgtatctggcgctt
tcctacgatcaccgtgtcgtcgatgggaaagaagccgtgactttcctggtgcgcgtcaaa
gagttgctcgaagatcctgcacggctggcgctcggcctgtag

DBGET integrated database retrieval system