KEGG   Methylocystis rosea: EHO51_15465
Entry
EHO51_15465       CDS       T05721                                 

Definition
(GenBank) undecaprenyl-diphosphate phosphatase
  KO
K06153  undecaprenyl-diphosphatase [EC:3.6.1.27]
Organism
mros  Methylocystis rosea
Pathway
mros00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:mros00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EHO51_15465
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mros01011]
    EHO51_15465
Enzymes [BR:mros01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.27  undecaprenyl-diphosphate phosphatase
     EHO51_15465
Peptidoglycan biosynthesis and degradation proteins [BR:mros01011]
 Precursor biosynthesis
  Diphosphatase
   EHO51_15465
SSDB
Motif
Pfam: BacA
Other DBs
NCBI-ProteinID: AZG78023
UniProt: A0A3G8M7S3
LinkDB
Position
complement(3196498..3197370)
AA seq 290 aa
MATACTNGLDTGFVDLGYWKVAVLGVVQGITELLPISSTAHMRIVPALLGWKDPGSAFSA
AMQLAALAAVVSYFWSDIRALAEGSVRALVRRDFNDWTFRFVVWIALATVPIGIAGLALS
HTLNTCGSPLRTLPVIGISCIVMAALLAIAELYCNHKRTLEHVSLKDAMIVGFAQVGALI
PGVSRSGSTLTAALFLDLKREEAARFSFLLGLPAIALAGLKELWELHKAQLDFHGWAVLT
LGLFVASISAFVAIWGLLRILERFSAWPFVFYRAFIGIVLLVGFYAGFLV
NT seq 873 nt   +upstreamnt  +downstreamnt
atggcgaccgcttgcacgaatgggctcgacaccggttttgtcgatctcggctattggaaa
gtcgccgttcttggcgtggtgcagggcatcaccgagcttctgccgatctcctccaccgcg
catatgcgcatcgtgccggcgctgctcggctggaaggaccccggctccgccttctccgcg
gcgatgcagctcgcggcgctcgccgccgtcgtcagctatttctggagcgacattcgcgcg
cttgccgagggatccgtgcgggcgctggtgcggcgcgacttcaacgactggacctttcgt
ttcgtggtctggatcgcgctcgcgaccgtcccgatcggcatcgccggcctcgcgctgtcg
catacgctcaacacctgcggctcgccgctacgcacgctgccggtgatcgggatttcctgc
atcgtcatggcggcgctgctcgccatcgccgaactctattgcaatcacaagcgcacgctc
gaacatgtcagcctgaaggacgcgatgatcgtcggcttcgcgcaggtcggcgcgctcatt
ccgggcgtctcgcgctcgggctcgactctgacggcggcgctgtttctcgatttgaagcgg
gaggaagcggcgcgcttttccttcctgcttggcctgccggcgatcgccctcgcgggactg
aaggagctgtgggagctgcataaggcgcagctcgatttccacggctgggcggtgctgacg
ctcgggcttttcgtcgcgtcgatctccgcctttgtcgcgatctggggcttgttgcgaatt
ctcgagcgcttctccgcctggcccttcgtcttctaccgcgccttcatcggaatcgtgctg
ctcgtcggcttctacgcaggctttttggtctga

DBGET integrated database retrieval system