KEGG   Moniliophthora roreri: Moror_10836Help
Entry
Moror_10836       CDS       T03137                                 

Definition
(GenBank) hexokinase
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
mrr  Moniliophthora roreri
Pathway
mrr00010  Glycolysis / Gluconeogenesis
mrr00051  Fructose and mannose metabolism
mrr00052  Galactose metabolism
mrr00500  Starch and sucrose metabolism
mrr00520  Amino sugar and nucleotide sugar metabolism
mrr01100  Metabolic pathways
mrr01110  Biosynthesis of secondary metabolites
mrr01130  Biosynthesis of antibiotics
mrr01200  Carbon metabolism
Module
mrr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mrr_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mrr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Moror_10836
   00051 Fructose and mannose metabolism
    Moror_10836
   00052 Galactose metabolism
    Moror_10836
   00500 Starch and sucrose metabolism
    Moror_10836
   00520 Amino sugar and nucleotide sugar metabolism
    Moror_10836
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Moror_10836
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mrr04131]
    Moror_10836
Enzymes [BR:mrr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     Moror_10836
Membrane trafficking [BR:mrr04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    Moror_10836
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 FGGY_N
Motif
Other DBs
NCBI-ProteinID: ESK87989
UniProt: V2Y8I8
LinkDB All DBs
AA seq 500 aa AA seqDB search
MPSSRRGSGSITLPSGQTMAIHTRTHEEEGLPHATKKTMADHLRRLENLFTLTPQRMRMI
VEAFKDTLELGLQKPGQVVPMIPTFVFGWPSGQEKGDYLALDLGGTNLRVCLVNVQGDGK
FEITQTKYRLTEEQKHDDGQKLFDFCAECIKTFIESNFTNDGGELSLKEGELLPLGFTFS
YPCTQNKIDHGELIRWTKGFGATNTEGRDVAEMFRKSLEKYNVPVNMTALINDTTGTLIA
SHYVNPRTKIAVIFGTGCNAAYMEKVSNIEKIKDLGIDENDEMAINCEWGAFDSFEHEHL
PRTKYDVTVDETSNKPGEQAFEKLISGRYLGEILRLVICELIDEGVLFLGQNTYKLETPY
VFETAFLSLMESDPTDELLMIIGIFTHFFALETTLAERQFFRALAKLIGRRAARLSACGI
AAIVSKMGYLDEGCSVGADGSLYNKYPGFADRVHEGLTDIFGDKGRNIITHHAEDGSGVG
SAIIAAMTKVRRDAGRYDHV
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgccatcatcccgtagaggaagtggcagtatcaccctgcctagcggccagaccatggct
atccatacgcgaactcacgaagaagagggtcttcctcatgcgaccaagaagaccatggca
gatcatttgcgaaggcttgagaacctgttcaccttgacgccccagagaatgcgaatgatt
gtcgaagcctttaaggatacactagaactgggtttgcaaaaaccgggtcaagtcgttcct
atgattccaactttcgtgtttggatggccatccgggcaggagaagggtgattacttggcc
ttggacctcggtggaaccaaccttcgagtctgccttgtgaatgttcaaggagacggaaag
tttgagatcactcaaacaaagtaccgtctcactgaggaacagaagcatgacgacggtcag
aagttgttcgacttctgtgcggagtgtataaagacctttattgagagcaactttactaat
gatggcggggaactgtcattaaaggaaggagagcttctacctctcgggttcacgttctcc
tacccctgcactcagaacaaaatcgaccatggtgagctcatccggtggaccaagggcttt
ggagctaccaataccgagggacgtgatgttgcagaaatgttccgcaagtctctagagaaa
tacaatgtacccgttaacatgacagcccttatcaatgacacgactggtacccttattgca
tcacactacgtgaaccctcgaaccaaaattgccgttatatttggcacgggttgcaacgcc
gcatacatggagaaggtcagcaacatcgagaagattaaagacctgggtatagatgagaac
gacgagatggctatcaactgtgaatggggtgccttcgactcttttgaacacgaacatctg
ccaaggacaaaatacgatgttacagttgacgaaacctcgaacaaacctggcgaacaagct
ttcgagaaactgatttctggtcgatacctgggcgagattctccgtctggtgatctgcgag
ctcattgacgagggtgtactgttccttggtcagaacacttacaagttagaaacgccatac
gtcttcgagactgctttcctatctcttatggagagtgacccaacagacgaattgctcatg
atcatcggtatcttcacccacttcttcgcactcgaaactacattagccgaaagacaattc
ttccgtgctcttgcgaagctcatcggacgacgtgctgctcgtctgagtgcatgtggtatc
gcagctatcgttagtaaaatgggatacctagatgagggttgttccgtgggtgctgatgga
tctttgtacaacaaatatcctggcttcgccgatagagtccacgaaggtcttactgacatc
tttggagataaaggacgcaacattattacccaccacgccgaagatggaagtggagttggt
agtgctatcatcgcagccatgaccaaggtcagacgcgatgctggccgctatgaccacgtc
taa

DBGET integrated database retrieval system