KEGG   Moniliophthora roreri: Moror_12155Help
Entry
Moror_12155       CDS       T03137                                 

Definition
(GenBank) ptenb protein
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
mrr  Moniliophthora roreri
Pathway
mrr00562  Inositol phosphate metabolism
mrr01100  Metabolic pathways
mrr04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:mrr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Moror_12155
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    Moror_12155
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mrr01009]
    Moror_12155
Enzymes [BR:mrr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     Moror_12155
    3.1.3.48  protein-tyrosine-phosphatase
     Moror_12155
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     Moror_12155
Protein phosphatases and associated proteins [BR:mrr01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    Moror_12155
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc Y_phosphatase CDKN3 Y_phosphatase3
Motif
Other DBs
NCBI-ProteinID: ESK82420
UniProt: V2WQB6
LinkDB All DBs
AA seq 561 aa AA seqDB search
MTDYIRRLVSGNKARFKDDEFELDLVYLTPRLIIMGYPASGIESLYRNPRGEVKKFLEGR
HGKGFWVWNLCPLRENEYTGKEVFDGRVTRWPWPDHHAPPLAFLPLVAQEIASWLKGEQG
RVGVLHCKAGKGRSGTMACSYLLLEAFSDSTSSAQKLVEEVIAATAAESSTHPEVTISPS
GDSRSGSVGAENKGKDPTQVLKDILDLHTSKRMRTVEGQEKQKQGVSIPSQRRWLGYYAR
ILHESCPPYFLSYKPGSTTSSLTSNDRVRLTHITLRMHPPSGLKKNLLKAANTILDRGKE
RGGRVWASLARYDDTMVSTVEGWILGDEKGGEEVFKDKDKMVRSFAKVGCADFGVEEGKG
EEKIVTYTLKGLSNKSWENIQEEVKGEENDVVPAVPEGVPPSAATSVADLAIIPPNTNGR
VQTNGEGVVLDANREVRVKLYMGQVFMGWLWLIPAFHMSADFDEKTVLKLTRKELDFPLG
IGKDIIDVEIGLEWVPSAPMTSPGAPIAEQGTTLMEPPDRKDALSPQGKSNMLASAVQGV
AAGDTVGGVRGVVEARQAGDD
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgaccgactacatccgccgcctcgtgtccggcaacaaagcgcgctttaaggacgatgaa
tttgaactagacttggtatacctcactccacgcctgataatcatgggttaccccgcctcg
ggaattgaatcgctctaccgcaatcccagaggagaagtgaagaagtttttggagggacgt
catggcaagggattctgggtgtggaatttgtgtccattgcgggagaacgagtacactggg
aaggaagtgtttgacggacgagtgaccaggtggccgtggcctgatcatcatgctccaccg
ttagctttcctaccgctggtagcgcaagaaatagcgtcatggttgaaaggtgaacaaggg
agagttggggtattacattgtaaagctgggaaaggccgttcgggaacgatggcgtgttca
tacctcttactcgaggcgttttccgattccacttcatccgcgcagaaactggtggaagag
gtcatcgcagccacggcagctgaatcaagcacgcatcctgaagtcacgatctccccgtca
ggagacagcagatcagggtccgtcggagcggagaacaaaggcaaggaccccacgcaggta
ctgaaggacattctcgacctgcatacctcgaaacgcatgcgaaccgtcgaaggccaagag
aaacagaagcagggtgttagtatacccagtcaacggaggtggttgggttattacgctcgt
attctccatgagtcttgcccgccatatttcctgtcatacaagcccgggtctacgaccagt
tctttgacttctaacgatagagtcaggttgacacatataaccctgaggatgcatccacct
tctggtcttaaaaagaatttgttgaaagcggcgaatactattcttgatcggggtaaagaa
cgtggaggtagagtttgggctagtttggcgaggtatgacgataccatggtatctactgtt
gaaggttggattcttggagatgagaaaggtggagaagaggtgttcaaggataaggacaag
atggtgaggagtttcgcgaaagttggatgcgctgattttggggtggaggaaggtaaaggc
gaggagaagatagtaacgtacacgctgaaagggttatcgaataagagttgggagaatatt
caggaagaggtcaagggcgaggagaatgatgtggtgccagcagttcccgagggtgtacca
ccgtcagctgcgacgagcgtagcagatctggctatcatacctccgaacacaaatggcagg
gtgcaaacaaatggcgaaggggtggtcctggacgctaatagggaggtcagggtgaagttg
tatatgggtcaggtattcatgggttggctgtggcttatacctgcttttcacatgtctgcc
gactttgacgagaagacagtcttgaagttgacaaggaaagaattagatttcccgcttggc
ataggcaaggacatcattgacgtggagattggactggagtgggtaccttcggctccaatg
acgagtccaggtgctcctattgctgagcaaggtactacacttatggagccacctgacagg
aaggacgctctcagcccgcaagggaagagcaatatgctggcttcggcagtacaaggtgtg
gcagctggggatactgtaggtggcgtcagaggtgttgtggaggctagacaggctggcgac
gattaa

DBGET integrated database retrieval system