KEGG   Moniliophthora roreri: Moror_13658Help
Entry
Moror_13658       CDS       T03137                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
mrr  Moniliophthora roreri
Pathway
mrr00020  Citrate cycle (TCA cycle)
mrr00190  Oxidative phosphorylation
mrr01100  Metabolic pathways
mrr01110  Biosynthesis of secondary metabolites
mrr01130  Biosynthesis of antibiotics
mrr01200  Carbon metabolism
Module
mrr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mrr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mrr_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:mrr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Moror_13658
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Moror_13658
Enzymes [BR:mrr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Moror_13658
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 FAD_binding_3 DAO HI0933_like Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: ESK90428
UniProt: V2WU83
LinkDB All DBs
AA seq 643 aa AA seqDB search
MRPILKRFRQPFSAAPWGARTLYGTARNGFLRTKTIARARELELASTSKFPLIEHEYDAI
VVGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAALGNMTNDDWRYHVYD
TVKGSDWLGDQDAIHYMCREAPSAVLELERFGVPFSRTSEGKIYQRAVGGQSLDYGKGGI
AYRCACAADRTGHALLHTLYGQSLRHNTNFFIEFFALDLIMQDGECLGVIALNMEDGTLH
RFRAHKTILATGGYGRAYFSCTSAHTCSGDGNAMVARAGLPLQDMEFVQFHPTGIYGAGC
LITEGCRGEGGYLLNSEGERFMERYAPTTKDLASRDVVARSMTIEIQEGRGVGSEKDHIY
LQLSHLPPEVIHERLPGISETASIFAGIDVTREPIPVLPTVHYNMGGIPTRYTGQVLTVD
EQGRDLVVPGLYAAGEAACVSVHGANRLGANSLLDIVVFGRSAAQHIKENLEPGRPHRAI
PEDAGIDSIEFMDRIREADGPEPTSKLRLEMQKVMQSNAAVFRTQDTLDEGLEKMRAIYR
RFDKVGIRDRSMIWNSDLIETLELRNLLQNAIQTMAAAAARKESRGAHAREDFPERDDEN
WMKHTLSFQHTSGPDVKLRYRNVVANTLDDKECKPVLPVKRVY
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgcgtccaattctcaagagatttcgtcagcctttttcagcggcgccatggggtgctcgg
actctgtacggaacagccaggaatgggtttctgagaactaaaacgatcgcgagagcgagg
gaactcgagcttgccagcacctcaaagtttccgttgattgagcacgagtatgatgccatc
gtagtgggagctggtggtgctggattacgggcagcttttgggttggcagaggctgggttc
aacacggcttgcatcagcaagctattcccaacaaggagccatacagttgccgctcagggt
ggtattaacgctgcgctcggtaacatgaccaacgacgattggcgataccacgtatacgat
accgtgaagggttccgactggttaggggatcaagatgcaattcattacatgtgtcgagaa
gcaccaagcgcagtcctagagctagagagattcggagtaccattctcccgaacctccgag
ggcaaaatctatcaacgagcggtcggcggtcaaagcctcgactacggtaaaggaggtatc
gcttaccgatgtgcatgtgctgccgaccgcacagggcatgctctccttcatacgctttac
ggccagtctcttcggcacaacaccaactttttcatcgaattctttgccttggatctcatc
atgcaagatggtgaatgcctcggtgtcattgcgctcaatatggaagatgggactttacac
cgattccgagcacacaagacaattctagcaactggaggatacgggagagcgtatttcagt
tgcacaagcgcacatacttgctcaggagatgggaatgctatggtcgcgagggctgggtta
ccgctccaggatatggaattcgtgcaatttcatccgacagggatatatggtgctgggtgt
ctcattaccgaaggctgtcgaggtgaaggcggctacctactcaactcggagggagagcgt
ttcatggaacgctatgcacctacaaccaaagatcttgcctcaagggatgttgttgctcgt
agtatgacgatcgagatccaggaaggaagaggtgtaggttccgagaaggaccatatctac
ttgcagctcagtcatctgccacctgaggtaatacatgagcgcctacctgggatctcggag
actgcgtcgatattcgcaggaattgatgtgactcgggaacctatacctgtcttgcccacc
gtgcattacaacatgggcggtattccaacgagatacaccggtcaagtcctcacagtcgac
gaacaaggtcgagatcttgtagtacctgggctgtacgcggctggtgaggcggcatgtgtc
tccgttcacggtgccaaccggctgggcgccaattctcttctcgacatcgtggttttcggt
cgttcagccgcacagcacattaaggagaatttggaacctggtcgaccacatcgtgctata
ccggaggatgctggtattgacagcatcgagttcatggacagaatccgtgaggccgacggt
cccgagcccacatctaaactgcgactcgagatgcaaaaggtcatgcagtccaacgctgct
gttttcaggacacaggacactctcgatgaaggtctagagaagatgcgtgctatttaccgg
cgcttcgataaggtcggcatccgcgatagaagcatgatatggaactctgacctcatcgaa
acgctcgaactgcgcaacctcctgcagaacgccatccaaacaatggcagctgcggcagca
aggaaggaatctcgtggtgctcacgcccgagaagactttcccgagcgggacgacgagaat
tggatgaagcacacgctctcctttcagcacacctctggcccggatgtgaagctgaggtat
cgaaacgtggtggctaatacccttgacgacaaggaatgtaaacctgtactaccggtgaag
cgtgtatattag

DBGET integrated database retrieval system