KEGG   Moniliophthora roreri: Moror_1496Help
Entry
Moror_1496        CDS       T03137                                 

Definition
(GenBank) glucoamylase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
mrr  Moniliophthora roreri
Pathway
mrr00500  Starch and sucrose metabolism
mrr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mrr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Moror_1496
Enzymes [BR:mrr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     Moror_1496
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15 CBM_20
Motif
Other DBs
NCBI-ProteinID: ESK93679
UniProt: V2YPS3
LinkDB All DBs
AA seq 579 aa AA seqDB search
MLLSGLFVSLLAIATSKVWAQSGTVESFIAFESPIAKAGLLANIGPSGSKSSGAKSGVVI
ASPSKQDPDYVYTWVRDSSLVFQWIIDQVTLGRDATLRSQIDNFVASQARIQQISNPSGT
ITTGGLGEPKFNVDETAFTGAWGRPQRDGPPLRAIALITWANYLVANKNQSYVTNTLWPI
IQHDLDYTAQYWNQTGFDLWEEVSSSSFFTTAVQHRALLQGAALATAIGQTSSVSTYTTQ
ASNVLCFLQSYWNVGQGYITANTGGGRSGKDANTVLTSIHTFDPAAGCDATTFQPCSDKA
LSNIVQYVNAFRSIYAINSGIPSNQPVATGRYPEDSYYGGNPWYLTTLAVAEQLYDALYV
WNQQKSLDVTATSLPFFQIFSPSVTTGTYASTSSTYTTLTTAIKSWADGFISVVAKYTPS
NGALAEQYNRATGVPLSASDLTWSYASALTAFGARAGQVPASWGAKGLTSTCTGSGGSPP
PSGSTVAVTFNVQATTTFGENIFLTGSVDALKNWSPENAIALSSANYPTWSVTVNVPANT
AIEYKYIRKFNSAITWESDPNRRITTPSSGTFTQNDSWR
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgttactctccgggctgtttgtcagtctcctcgccattgcgaccagcaaggtgtgggct
cagtctggcactgttgagtcctttatcgccttcgaatcccccattgcaaaggctggttta
ctggccaacattggcccatcaggatccaagtcttctggggcgaagtcaggagtcgtcatc
gcgtcgccttccaagcaggaccctgactatgtttacacctgggttcgtgattcgtccttg
gtattccaatggattatcgaccaggtcactcttggtcgggatgccaccttgagatctcag
atcgataattttgtcgcttcccaagctcgcatacaacaaatctcgaacccttcgggcacc
attaccaccggcggattgggcgagccaaagtttaatgttgatgaaacagccttcaccggt
gcctggggtcgcccccaacgagatggtcctcctcttcgtgcaattgcgctcattacctgg
gccaactacctagtcgcgaacaaaaaccaatcctatgtcaccaacacgctctggcccatc
attcaacacgatcttgactacaccgctcaatactggaatcagacgggtttcgatctttgg
gaagaggtctcttcctcctcattcttcacgactgccgttcaacaccgagccttgctccaa
ggtgctgcactcgccaccgcgattggccagacttcaagtgtgtctacatacacgactcaa
gccagtaacgttctctgcttcctccagtcgtactggaatgttggtcagggctatataact
gcaaacaccggcggaggccgctctggaaaagatgccaacaccgtgttgactagtatccac
actttcgatcctgcagccggatgcgacgcgaccacttttcagccatgctctgacaaggcg
ctttccaacatcgtgcagtatgttaacgctttcaggagcatctacgccatcaactctggt
atcccatcgaaccaacccgtagctaccggacgatacccagaagattcctactacggcggc
aacccctggtacctaactacccttgccgttgccgaacagctctacgatgctctctatgtt
tggaaccagcagaaatcgctcgacgttacagccacttctctccccttcttccaaatcttc
tctcccagtgtcactactggcacttacgcttccacttcatctacttacaccactctcact
actgccatcaagagctgggctgatggatttattagtgtagtcgccaaatacaccccgtcc
aacggagcccttgcagagcagtataacagggccactggtgtacctctcagtgcaagtgat
ctgacgtggagctatgcatcggctttgactgcttttggtgcccgagcaggtcaggtccct
gctagttggggagccaaagggttgacttcgacttgcactggcagcggtggctcgccccct
cccagtggatcgactgttgctgtaacctttaacgttcaggctacgactactttcggtgaa
aatatcttcctgaccggttccgttgatgccttgaagaactggtcgccggaaaatgcaatt
gccttgtcttccgctaactatccaacttggagtgtgactgtcaacgttcctgccaacacg
gccattgaatacaagtacattcgcaagttcaacagcgccattacttgggagtctgacccc
aacaggagaatcacgactccttctagtggaaccttcactcagaatgatagctggcgttga

DBGET integrated database retrieval system