KEGG   Moniliophthora roreri: Moror_15244Help
Entry
Moror_15244       CDS       T03137                                 

Definition
(GenBank) elongation factor tu
  KO
K02358  elongation factor Tu
Organism
mrr  Moniliophthora roreri
Brite
Translation factors [BR:mrr03012]
 Eukaryotic Type
  Elongation factors
   Moror_15244
 Prokaryotic Type
   Moror_15244
Mitochondrial biogenesis [BR:mrr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Moror_15244
Exosome [BR:mrr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Moror_15244
  Exosomal proteins of breast cancer cells
   Moror_15244
  Exosomal proteins of colorectal cancer cells
   Moror_15244
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW
Motif
Other DBs
NCBI-ProteinID: ESK87877
UniProt: V2X224
LinkDB All DBs
AA seq 439 aa AA seqDB search
MIGLATCKAASRSFVSVSFPRFSVAKFSLPLSVTFGSRRGYASYNRTKPHMNIGTIGHVD
HGKTTLTAAITKVLAEKGGATFTDYAQIDKAPEEKARGITINSSHVEYETDTRHYGHIDC
PGHADYIKNMITGAAQMDGAIIVVSATDGQMPQTREHLLLARQVGIKKLVVFINKVDMIS
DKEMLELVDMEMRDLLSTYNFDGENTPIVMGSALAALEDRDPEIGVQKIQELVDACDAWL
ELPARDLDKPFLMAIEDVYSISGRGTVVTGRVERGTATKGSEVEILGLGDSIKTTMTGVE
MFHKELERAEAGDNMGALLRGVKREQIHRGQVLIAPGSMKAAKKFRAQVYILTKDEGGRY
TPFMEGFRPQLFLRTADVTVTLKFSQGTPDASNKMAMPGDNVELDCELYHDLAMDVGSRF
TLRESHKTIGTGVVTKILE
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgattgggctggctacctgcaaagctgcctcccgcagttttgtctcggtctctttccct
cgtttttccgtcgccaaattctctcttcctctgtcggtcacgtttggctctcggagagga
tatgcttcgtacaatcgtacaaagcctcacatgaacattggcactatcggacacgtcgac
cacggaaagacaacacttacggctgctattaccaaagtccttgctgagaagggaggtgct
accttcaccgactatgcccaaatcgacaaggccccagaagagaaggcgcgaggtattact
atcaactcttctcacgtcgagtatgagacagacacacgtcactatggccatatcgattgt
cccggacatgccgattatatcaaaaacatgattactggtgctgctcagatggacggtgct
atcattgtcgtatcggcaacagacggacagatgcctcagactcgtgaacacttacttttg
gctcgtcaagtcggtatcaagaagcttgttgttttcatcaacaaagtggatatgatttcg
gacaaggaaatgcttgagttggtcgatatggaaatgcgtgacctcttgtccacctacaac
ttcgacggagagaacacacctattgtcatgggctctgcactggctgctttggaagataga
gaccccgagattggtgttcagaagattcaggaactggtcgatgcttgtgatgcttggctt
gagctcccagcccgtgacctcgacaagcctttcctgatggccattgaagacgtctactcg
atttctggacgtggtactgtcgtcactggacgggttgagcgtggcactgccaccaagggc
agcgaagtcgaaattctgggattgggtgactccatcaagacgactatgaccggtgttgag
atgttccacaaggagctcgaaagggctgaagctggtgacaacatgggtgctttgcttcgc
ggtgttaaacgtgagcaaatccaccgtggtcaggtcctcatcgccccaggatctatgaag
gccgcgaagaaattccgcgctcaagtttatatcttgaccaaggatgaaggtggtcgttac
actcccttcatggaaggcttccgcccccaacttttccttcgcactgcagacgtcacagtt
acgctcaagttttcccaaggcactccggatgcctccaacaagatggccatgcccggtgat
aacgtcgaactggattgcgaactctaccacgacctggctatggatgttggttctcgtttc
actcttcgcgaatcacacaaaaccattggtactggcgtcgtcacaaagattcttgagtaa

DBGET integrated database retrieval system