KEGG   Moniliophthora roreri: Moror_16963Help
Entry
Moror_16963       CDS       T03137                                 

Definition
(GenBank) cytochrome p450
Organism
mrr  Moniliophthora roreri
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-ProteinID: ESK84206
UniProt: V2WUJ9
LinkDB All DBs
AA seq 503 aa AA seqDB search
MSHVLVQLFSAISAIWIVGKIVQQRVANAKLRNIPPVGGDGYFSSYVTAFRFFGHAKELV
LEGYEKYQGRVFKIPRLTKWIVVVTSPQLVDELRKAPDECLSFEEAVNDSLQVEHTLGGP
IHHDPYHIGVVRGALTKNLGVKFDEVSEEIAAAFGDEMPATNEWTKRSVSDSILQIVARA
SNRLFVGLPLCRNKEYLDLNIKFTIQVVVSAQLINMFPEFMKPFVGQFLTSVPKSIKLAR
KFLDPIILERSEKQEAHATSDSGWEDKPNDFLMWLMDIATGPQRTTHDFVMRILTVNFAA
IHTSSMTFTDALYYLAAHPQYVPELREEIENVVKKDGWSKASFQQMRKLDSFLKEVGRIA
GLGGLTSARKVMKDFTFSDGTTVPAGTTVSLPSAGVHLDSKNYENPYVFNPWRFSDIRSS
SSDESIKHQMSSPNIEYLLFGSGRHACPGRFFAVNELKLLLSHVLMNYDVKFDGEGGVPN
ATWFGASRVPDRKAEVMFRKRQM
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgtcccacgtcctcgttcaacttttttccgccatttcggctatatggattgtggggaag
atcgtacaacagcgagtggcgaatgcaaagcttcgaaacatacctcctgtgggcggtgat
ggttacttctcttcatacgtgacggcgtttaggttctttggacatgcaaaggagttggtt
ttagagggctatgagaagtatcaaggaagagtattcaagattcctcgtttgacaaagtgg
attgtagtcgttacgtcgcctcaacttgtcgatgaactaaggaaggcaccggatgaatgc
ctctcgttcgaagaagcggttaacgactccttgcaagtagaacacacgctgggtggtcct
attcaccacgatccctatcacatcggcgttgtacgaggggcgttgacgaagaacctgggt
gttaaatttgacgaagtgagtgaggaaattgcggcagcatttggtgatgaaatgcctgcg
actaatgaatggaccaaacgctccgtatcagactccatcctccaaatcgtagcaagggca
agtaataggttgttcgttgggctaccgctgtgtcggaataaggaatacctcgacctcaac
ataaaattcacgatccaagttgtcgtctcggcgcagttgatcaatatgttcccagagttt
atgaagccatttgtcggccagttcctcacctccgtcccgaaaagtatcaagctagcaaga
aagttcttggaccctatcattctggagcggtcggagaagcaagaggcgcacgcaacttct
gatagcggatgggaggataagcccaatgatttcttgatgtggcttatggacatcgctaca
ggccctcaaagaaccacgcatgatttcgtgatgaggattttgacggttaattttgctgcc
attcatacttcgtccatgaccttcacagatgccctgtactacctcgccgcacaccctcaa
tatgtccccgagcttcgggaggaaattgaaaatgtcgtgaagaaggacgggtggtcgaaa
gcgagtttccagcagatgcgcaagttggatagtttcttgaaggaagttgggaggattgcc
gggttgggtggactgacgtctgcgcgtaaagtcatgaaagactttaccttctctgatggg
acgactgttcctgctggcacgacagtttcgcttccgagtgctggggtgcatttggactcc
aaaaactacgaaaacccatacgtgtttaacccatggcgtttctcagacatccgctcctcc
tcctcagacgaaagcatcaaacatcaaatgagcagccccaacatagagtaccttcttttt
ggttcgggaagacatgcctgtcccggaaggttcttcgcagttaatgagttaaagttgctt
ttgtcccacgttctgatgaactatgatgtcaagtttgatggagaaggaggagtaccaaac
gcaacatggtttggtgcgagtagggtgccggataggaaggcggaggttatgtttaggaag
aggcagatgtag

DBGET integrated database retrieval system