KEGG   Moniliophthora roreri: Moror_2298Help
Entry
Moror_2298        CDS       T03137                                 

Definition
(GenBank) histone deacetylase
  KO
K11484  histone deacetylase HOS3 [EC:3.5.1.98]
Organism
mrr  Moniliophthora roreri
Brite
KEGG Orthology (KO) [BR:mrr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mrr03036]
    Moror_2298
Enzymes [BR:mrr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     Moror_2298
Chromosome and associated proteins [BR:mrr03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     Moror_2298
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl DUF848
Motif
Other DBs
NCBI-ProteinID: ESK85912
UniProt: V2WWE7
LinkDB All DBs
AA seq 589 aa AA seqDB search
MPSIPGNFAVFIQDVCYKHKFIRSRDTSTIVERPERLRAVKVGLAAALSRLEEVHSASSS
KTSNRSDDPDILAAALDKMKLEGSSTSQSTFGPITVVHSAATMPLLDSPAVKFVHGDIEG
DVYLENVSKWAAESAEKIGRGESEIPEGLPQGDLYLCPESIIAMEGAIGTTCEAVDVVMS
GTLPSSATEAAASSGIKRAFVAVRPPGHHCGEDTPCGFCFVNNVAVAAAHAHLKHGIKRA
VIFDIDLHHGNGTQSIIWQINEETYRQTVEAEADAPITDPGPKVYYGSIHDILSFPCEDG
KPELVQAASVSIHDAHGQWIENIHLKPYDNEEGFHALYEKEYRKIIERAEHFLDNTGGAG
EDVLVFISCGMDACEHEYTSMSRHNRKVPVSFFDRFTQDACAFADRYAKGRLVSVLEGGY
SDRALISGTLAHICGLVDIPSESREALKDSWSLDNLIKLEKATKKRAARSARPSGVGASS
EPWLERAVAIFTSIDANGAAILAASPKAASRSKVVPPSSRTLRERKKPKGSHAVPVAQED
ASDASLLSSLSDSEGDQVVAPALGGGVSGTEKKLPRVILRLGPDPLSKQ
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgccatccatacccgggaattttgctgtttttattcaggatgtttgttacaagcacaag
ttcattcgctcgcgggatacttcgactatagtcgaacgtccagaacgtcttcgagctgtc
aaggtcggacttgctgctgccttgtctcgccttgaggaagtccattcggcgtcatcttcg
aaaacatcgaatagaagcgacgatccggatatcctcgcagctgcactggacaagatgaaa
ttggagggatcttcgacctcacaatctacgtttggtcctatcacagtggtccacagtgct
gccaccatgccattgcttgatagccctgcggtcaagtttgtccatggcgatatcgaagga
gatgtttatctggagaacgtatccaagtgggcagcggagagcgctgagaagattgggcgt
ggggagtcagagataccagaaggcttacctcagggtgacttgtatctatgtccagaatcg
atcatcgctatggaaggtgcgattgggactacatgcgaggcggttgacgtcgtgatgagt
ggcacactaccctcttcagcaacagaagctgctgcaagcagtgggatcaagcgagcattt
gttgctgtacgaccaccaggtcatcattgcggagaagatacgccttgtggtttctgtttc
gtcaataacgtcgctgttgccgccgctcatgcgcatctaaagcacggtatcaaaagagca
gtcattttcgacattgacctgcatcatggaaatggaacccagtccatcatatggcaaatc
aacgaggaaacttataggcagacggtcgaagcagaagcggatgctcccatcacagatcct
ggtccgaaggtttactatgggagcatccacgatattctctcttttccatgtgaagacggg
aaaccggaactcgttcaagcagcgtctgtgtctattcacgatgcccatggacaatggata
gagaatatccatttaaaaccgtacgacaatgaagaaggattccatgcgttatacgagaag
gaatacaggaaaatcatagaacgagcagaacactttctcgacaataccggaggtgctggc
gaagatgtattggtatttatcagctgcggaatggatgcatgcgaacacgagtacacgtcc
atgtccaggcataatcgaaaagtccctgtatcattcttcgatcgcttcacccaagacgca
tgtgcgtttgccgataggtatgccaaaggccgcctagttagcgtgcttgaaggcggttat
agtgatagggctttgatcagtggtaccctggcccacatatgcgggctcgtggacatccca
tcggaatcgagggaagcgctgaaagattcgtggagcctagacaatctcatcaagctcgaa
aaagcaaccaagaaacgtgctgcccgtagtgcaaggccatctggcgtaggcgcctcttca
gagccttggctagaacgtgccgtggcgattttcacttccattgacgcaaacggtgctgct
attctcgctgcttccccgaaggcggcatctcgttccaaagttgtaccgccgtcttcgagg
acattgcgggagagaaagaagcctaagggcagccatgctgtgcctgtcgctcaagaagat
gcttcggacgcaagcttgctgagttcgctctccgatagtgaaggtgaccaggttgttgct
ccggcgctgggaggaggcgtgagcgggacggagaagaagctgccaagagttatcttgcgg
ctagggcccgatcccttgtcgaaacaatga

DBGET integrated database retrieval system