KEGG   Moniliophthora roreri: Moror_2316Help
Entry
Moror_2316        CDS       T03137                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
mrr  Moniliophthora roreri
Pathway
mrr00250  Alanine, aspartate and glutamate metabolism
mrr00410  beta-Alanine metabolism
mrr00430  Taurine and hypotaurine metabolism
mrr00650  Butanoate metabolism
mrr01100  Metabolic pathways
mrr01110  Biosynthesis of secondary metabolites
Module
mrr_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mrr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Moror_2316
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Moror_2316
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Moror_2316
   00430 Taurine and hypotaurine metabolism
    Moror_2316
Enzymes [BR:mrr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     Moror_2316
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ESK85893
UniProt: V2WGB8
LinkDB All DBs
AA seq 540 aa AA seqDB search
MALSKHIDPDRLLQDSHDKKTKHHVLTKTDPNEIQHSYGARYGTNPIPKYHLPSKGIEAD
SAYQLIHDELALDGSPVLNLASFVHTWMPPQADKLMQENISKNLIDCDEYPATQILHTRC
ISMLAHLWNAPRAKNAIGTATTGSSEAIQLGGLAMKRIWQEKQKAAGKSIHEPGPNIVMG
ANAQVALEKFARYFDVECRLVPISVESKYRLDPKKAMQYVDENTIGVFVILGSTYTGHYE
PVKEMADLLDEYEKNTGISVPIHVDAASGGFVAPFATPDLVWDFKIPRVVSINTSGHKFG
LSYVGVGWVVWRDKAHLPKDLIFELHYLGSVEYSFSLNFSRPAAPIIAQYFNLIHLGFEG
YRNVALNDLRNARLLSRALEGSGYYMVLSDIHRQAPGSAASLGAPTKGSGKTEAADNYEP
GLPVVSFRFSDDFKQKYPDIQQKWIQTLLRAKGWIVPNYELAPDLESIEILRVVVRENMS
EVLIDRLVADLIEVTEQLMKSDSSIHALNNLGTTHSSRPEAVHGRMDEGSKPSGTYAKQC
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atggctctctccaagcacatcgatccagatcgtctgctacaggactcccatgacaagaag
acaaaacaccatgttctaaccaagaccgatccaaatgagatacaacactcatatggcgca
cgctacggaaccaatcccatccccaaataccatcttccatccaagggaatcgaagcagac
tcggcgtatcaacttattcacgacgagctcgccctggacggttccccagtcctcaacctt
gcatccttcgttcatacgtggatgccccctcaggcagacaaactcatgcaagagaacata
tccaaaaacttgatagactgtgatgaatatccagccactcagatcttgcatacacgttgc
atctcgatgcttgcacacctctggaatgccccacgcgccaaaaacgccatcggcaccgca
acaactggttcatcggaagctattcagttgggtggcttggccatgaagcgcatttggcaa
gagaaacaaaaggcggcaggaaaaagtattcatgaacctggacccaacatcgtcatggga
gctaatgctcaagttgctcttgagaagtttgctcgatacttcgacgttgaatgccgtctg
gtccccatttctgttgaaagcaagtaccgtcttgaccccaaaaaagcaatgcagtatgtg
gacgaaaacactattggagtgtttgtgattctaggaagcacatacactggccactacgaa
cccgtaaaggagatggcggaccttttggacgaatacgaaaagaacactgggatctcagtc
cctatccatgtcgatgcggcttccggtggctttgtagccccattcgccacgccggacttg
gtatgggatttcaagattcccagggtcgtttccatcaatacttcaggccacaaattcggt
ctatcatatgtcggagttggttgggtcgtctggcgcgacaaagctcacctccccaaagat
ctcatcttcgaactccactatctcggttcggtggaatattccttctcgctcaacttctct
cgacctgcagcgccgattattgcccagtatttcaatttgatccatttaggattcgagggt
tataggaatgttgcgctaaatgatctgaggaatgcgaggctacttagtagggcacttgaa
ggaagcgggtattatatggttttgagtgatatccaccggcaggctccaggatctgcagcg
agtcttggagctcccacgaagggctcggggaaaacggaggctgcagataattacgaacct
ggtttgccagtcgtatccttccgattctcggatgacttcaagcaaaagtacccggacatc
cagcagaagtggattcagacactcttgcgtgccaaaggatggattgtgcccaattatgag
ctggctcccgaccttgaaagcatcgaaatcctccgagtcgtcgttcgtgagaatatgtcg
gaagtgctcatcgatcgtctagtcgcggacctgatcgaggtcaccgagcaactgatgaaa
agcgactcgtccatccacgcgttgaataatctggggactacccattcctctcggcctgag
gcagttcatgggaggatggatgagggtagcaagccttcgggaacgtatgccaagcaatgt
taa

DBGET integrated database retrieval system