KEGG   Moniliophthora roreri: Moror_5713Help
Entry
Moror_5713        CDS       T03137                                 

Definition
(GenBank) phosphatidylethanolamine n-methyltransferase
  KO
K16369  phosphatidylethanolamine N-methyltransferase [EC:2.1.1.17]
Organism
mrr  Moniliophthora roreri
Pathway
mrr00564  Glycerophospholipid metabolism
mrr01100  Metabolic pathways
mrr01110  Biosynthesis of secondary metabolites
Module
mrr_M00091  Phosphatidylcholine (PC) biosynthesis, PE => PC
Brite
KEGG Orthology (KO) [BR:mrr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Moror_5713
Enzymes [BR:mrr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.17  phosphatidylethanolamine N-methyltransferase
     Moror_5713
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEMT ApoLp-III SKICH HECW_N
Motif
Other DBs
NCBI-ProteinID: ESK87337
UniProt: V2X0I6
LinkDB All DBs
AA seq 988 aa AA seqDB search
MAGSPNGLRKRRPGSPADTGGAGPEKREPKPAAREEIWGKTPGGEVFRVPITHDVLTLFN
PAYPKSHLDILNLGLLGFQIVLFFILPRHASQVFFLFYFAFWRAAYDAGLGWVLTKQSKR
KWIVREVQKRGWLDEKRRPVVRSWIRAQLAGKMGKDYSFDELPLEYNTWLLFRQAVDIIL
LNDFVAYCMFAFACFRVPHGLSTFIHVMRWIGGLLLIGFNLWVKTEAHNVVKDYGWYWGD
CFFQRGNLVFDGVFELAPHPMYSVGYAGYYGLSLIAGSYAVLFISLAAHAAQFGFLVFFE
NPHIERNYIKPKAIARRTPILIPEVESQSVTPEDPAELPTPSATEGETATETEELETETE
VEEESVLRETRQAKKQHRPQISSASSISLPSGTEIVTAPKRKTISQHDLLNKYFRRDTVV
LKNLDLLRSNDAMLVLIIFYSLSFSLLPQLSDNILLAIHFTHAFAWTLFHCFGLGLLLRA
QSESRFLVKHFISNYYYPPNDGGKGAVLEAFNNWKAIYNMSLCMTNVSFIGVVWRTYSIP
REWTVGHELLRHTLGIILIGLHIWASWESYEVLGVFGWFFGDFFMEEFPAHLEYSGIYRY
LNNPEMMGGAAWFGLSLIGGSKLVLCLAVLRHLAHWWFLSSVENPHMRKLYGDSLRKEAG
FVKVIKNVASRNARILESRAGRHAPEIKRVAKEVKGTFDKVLEETADVVEEFLAKSRPKI
SEVVQDTKVLLQQSREKLVITRVANDLSSYDTSKYKVVILPSSESSLRFMFGEPINVRWQ
APHMHSRKDWIGIYRVGANKPTLVTRTSSMGMWVPVYDEEWDGDVPLGLDRPDVPMRESE
SGVVTFKGNTLPWQVGRYEVRYHHDGKYNVMSIDGPFEIYVDRPSELDFTSVRQSLMRIV
PLCLDSDPALIPLSCKPSQEGEGPSRGDDNEPPDDRDQDDFSFWSERQAKRICTALKQAF
DVEYAPEVVVADANLTALANRVLLSKKM
NT seq 2967 nt NT seq  +upstreamnt  +downstreamnt
atggcgggctctccaaacggtctgcgtaaacggcgaccaggttcaccagcagatacaggt
ggagctggaccagaaaaacgcgagccaaagcctgcggcacgtgaggaaatctggggaaag
acacctggcggagaagtgtttagagtgccaattacccatgatgttcttactctattcaat
ccggcgtacccaaagagtcacctcgatatcctgaatttgggtttactaggcttccaaatc
gtcctattctttatcctacctcgccacgcgtcacaggtgttcttcctgttctatttcgca
ttttggcgtgcagcatacgatgctggccttggatgggtcctcaccaagcagagcaagaga
aaatggatcgtgcgtgaagtacaaaagagaggctggctggatgagaagaggcgccccgtg
gttcggagctggatccgtgctcaattggctgggaagatgggcaaggattattcttttgac
gaactccccctagaatacaacacttggcttctattccgtcaggctgtggacatcatcctg
ctaaacgatttcgtcgcatactgcatgtttgcattcgcgtgtttccgcgtacctcatggt
ctttcaaccttcatccacgtaatgagatggatcggtggactacttctcattgggtttaat
ctctgggttaagacggaggcacacaacgtggtcaaagattacggctggtactggggcgac
tgtttcttccagcgcggtaatttggtctttgatggcgtctttgagttggcaccacatccc
atgtactccgtcggttacgctggatactatggactctcgctcatagcaggtagctatgcc
gttctgttcatcagtttggccgctcatgcagcacagttcggattcttggtgttctttgag
aatcctcacattgaacgtaactacatcaagcccaaggctatcgctagaaggacgcccatc
ctcattcctgaagtggaaagtcagagtgtaacacctgaggaccctgccgagcttcccacc
ccgtctgctactgaaggagagaccgccaccgagacggaagaactggaaacagagacagag
gtagaggaagagagcgtacttcgcgagactaggcaagccaagaagcaacaccgacctcaa
atctcctcggcgagctcgatttcattgccaagcggaactgaaatagttacggcccccaag
aggaagaccatttctcagcatgatctcttgaacaagtactttaggcgggataccgtcgtg
ctgaagaacttggatcttcttcgctccaacgatgccatgctcgtgcttatcatcttctat
tccctgtctttctcgcttctaccccagctgtcggataatatcctgctggccatccacttt
acacatgcgttcgcatggacgttgttccattgctttgggcttggactattactccgtgct
cagagcgagagtcggttcttggtaaaacattttatcagcaactattactaccctccaaat
gacggcggtaaaggagccgtacttgaagccttcaacaactggaaagcgatatacaacatg
agtttgtgcatgaccaatgtttcatttattggtgtcgtatggcggacctactctatacct
cgggaatggacggttggccatgagctgctacgccataccctagggattatccttattggg
ttgcatatctgggcgtcatgggaatcttatgaagtcttgggagttttcggctggttcttt
ggtgacttcttcatggaggagttccccgctcatttggaatattctggtatatacagatat
ctgaacaatcccgaaatgatgggaggagccgcttggttcgggttgagcctgatcggcggg
agcaagcttgttctctgtctcgcggttcttcggcacctcgcccactggtggttcctgagc
agtgtagaaaatccccatatgcggaaactctatggtgactcgctgcgcaaagaagccggg
ttcgtcaaagtcatcaagaatgttgctagtaggaatgcaagaattcttgagtctcgagcc
ggtcgacacgctcccgagatcaagcgtgtcgccaaggaggtcaaggggacgtttgacaag
gtcttggaggaaactgcggacgtcgtagaggagtttttggcgaaatctcgacccaagatt
tctgaagttgtccaggacaccaaagtccttttgcaacaatccagggaaaaactggttatt
acgcgggttgcaaatgacttgtcgtcttatgatacatccaagtacaaggttgtcattctg
cccagctcggaaagttctctgagattcatgttcggggaacccatcaacgtgaggtggcag
gcgccacatatgcattcccgcaaagactggatcggaatctatagggttggtgcaaacaaa
ccgacactggttacaaggacgtcttcgatggggatgtgggttccggtttatgatgaagaa
tgggacggagatgtaccactgggtctagacagacctgacgtacctatgagggagtctgaa
agcggggtcgtcaccttcaagggtaatactcttccttggcaagttgggcgctacgaggtg
cgatatcatcatgatggaaaatacaatgtcatgagcattgatggcccgttcgagatatat
gttgacaggccttctgagctcgactttacctcagtccgacaaagtcttatgcgaatagtg
cccctttgcctggactctgatcctgctttgataccactatcctgcaagccgtctcaggaa
ggcgaagggccgtcccgaggtgatgataatgaaccgcctgacgaccgggatcaggatgac
ttcagcttttggtcggaacgacaggctaagcgtatatgtactgcgttgaaacaggcattc
gatgtggagtacgcgccggaggttgtagtggccgatgctaaccttacggctctggcgaat
cgggtactattgtccaagaaaatgtga

DBGET integrated database retrieval system