KEGG   Moniliophthora roreri: Moror_6291Help
Entry
Moror_6291        CDS       T03137                                 

Definition
(GenBank) aspartyl glutamyl-trna amidotransferase subunit b
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
mrr  Moniliophthora roreri
Pathway
mrr00970  Aminoacyl-tRNA biosynthesis
mrr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mrr00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Moror_6291
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mrr03029]
    Moror_6291
Enzymes [BR:mrr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Moror_6291
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Moror_6291
Mitochondrial biogenesis [BR:mrr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Moror_6291
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GatB_N GatB_Yqey YqeY
Motif
Other DBs
NCBI-ProteinID: ESK97070
UniProt: V2XWZ6
LinkDB All DBs
AA seq 505 aa AA seqDB search
MSRLILDGWQVVIGIETHVQLKTRQKLFSRANTSLLSHSPNSRHNAFDAAFPGTLPKLNP
KCLDLAVRAALALNCKVQNRSSFDRKHYFYSDQPVGYQITQHYAPFALNGFLKPPKLDLP
VRIKQLQLEQDTGKSIYNARSRISSIDLNRAGTGLLEIVTEPDLSSPEEAAEYVRSLQST
LRAMGVSDGNMEAGDLRCDVNVSMNRPGEARGTRCEIKNLNSVRFMVAAIHHEIERQKGI
LSSNSSVLQETRGFDENRFETYTIRSKEDAPDYRYMPDPNLGVLIVNDTTIERIRKSLPE
SPEAMRTRLLTTYGPHGVNNASIDVLMGLDASRDVPFDGEVSSQQESAVPYFEALAQGRD
PREVVNWITQILLGQLSSLNQTFSPKHLSVPQMGELIDLVISGKMTRSSGKLLLRHVLTN
PSPSVLMKEMATHLDLIVSEAEEDTDQYTEICSRAIAALPSEVAAIQAGNVNVMNKLIGR
VMRDTKGKVDVQKVRKTMESLIKIS
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgtctgatccttgacggctggcaggtcgtcattggcatcgaaacccatgtgcag
ctaaaaactcgtcaaaagctattctctagagccaatacctctcttctcagtcattcgcca
aactcccgacacaatgcattcgatgcagcattccccggaacgttacccaaactcaatccg
aaatgtctcgacctagcggtgagagctgcgttggccctcaattgcaaggtccagaaccgt
tcttctttcgacagaaaacactacttctattcagaccagcccgtggggtatcaaattact
caacattacgcgccgttcgcactcaatggcttcctgaaacccccaaaactcgacctccca
gtgcgaatcaaacagctccaactcgaacaggacacagggaaatccatatacaacgcgaga
agtcgcatttcctcgatcgacttgaacagagcaggaacaggtctcctggagatcgtcact
gagcccgacctgagctctccagaggaggctgcagagtatgtgcgttcactacagtccaca
ttgcgcgctatgggtgttagcgacggaaatatggaggcgggtgacttgaggtgcgacgtt
aacgtatcgatgaaccgaccaggggaagccaggggaacacgctgtgaaatcaagaatctc
aacagtgttaggtttatggtggctgctattcaccatgaaattgaacgccagaaaggcatt
ctctcttcaaactcatctgtacttcaagaaacgcgtggttttgatgagaaccgatttgaa
acctacacaatccgttcaaaggaagatgctccagactaccggtacatgccagatcccaat
ttgggcgtacttatcgttaacgacaccaccattgaacggatccgcaagagcttaccagaa
tctccagaagctatgcgcactcgactactcacaacctatggaccccatggcgtaaacaat
gctagcatcgatgtgttaatgggtctggacgcctcacgggatgttccttttgatggtgaa
gtttcttctcagcaagaaagcgctgtcccttattttgaggccctggcccaaggaagagac
ccgagagaggttgtcaattggataactcagattttgttgggacagctttcgtctctgaat
caaaccttctcaccaaagcacttatcggttcctcagatgggcgaactcatcgacctggtc
atttccgggaagatgaccagatcgtctggaaaactccttttacgccacgttctaacgaac
ccttcaccttcagtgctcatgaaggaaatggcaactcatctcgacctgatcgtatcagag
gcagaggaggataccgaccaatatacggagatatgttctcgagcgatcgccgccctccca
tctgaagtggctgccattcaagctggaaatgtcaatgtaatgaacaaactcatcggtcgg
gtcatgagggataccaaaggcaaagttgacgtgcagaaagtgaggaagacgatggagtct
ttgattaagatatcgtag

DBGET integrated database retrieval system