KEGG   Moniliophthora roreri: Moror_6735Help
Entry
Moror_6735        CDS       T03137                                 

Definition
(GenBank) histone-lysine n-methyltransferase
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
mrr  Moniliophthora roreri
Pathway
mrr00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:mrr00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    Moror_6735
Enzymes [BR:mrr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     Moror_6735
Chromosome and associated proteins [BR:mrr03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     Moror_6735
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRI SET V_ATPase_I
Motif
Other DBs
NCBI-ProteinID: ESK96718
UniProt: V2XC11
LinkDB All DBs
AA seq 877 aa AA seqDB search
MSQTYVENYSSSLTTQTTAATATTGTMKKSKSPPLTPLSSRCSQADQSSVTKSDLKPEPD
LPLDLCLPPSTAKPMSVKQESPSASRSHSPSIPDVKPPVKEEDYGSPMLDDTTPASGSSS
KGPSPPATTAAGSSSSRKAAASAPQLIGHLPVAREEALASFTEMPDNWYQYKSLGRSREL
LESMTCECLFDPDSDHPEVACGHSSDCINRLTQVECLPGDCRCGDYCQNQRFQKKEYASI
EIVKTEMKGYGLRIEGDIQKDTFIYEYVGDVVNNQSFKKRMREYANEGIQHFYFMMLQKD
EFIDATKNGGIGRFANHSCNPNCYVAKWTVGTTVRMGIFAKRNIKKHEELTFNYNVDRYG
HQAQTCYCGEPNCVGFIGGKTQTDVSTMDDLYLDALGITDDADVAALKGNKKKKGKKIDD
PDFMPQMKPIVEKEVPKVVQALRQVQSKKVLSKLLTRIKITEDGASLRQIMRLRGFSIMK
NILEDYAEDLDVIALALQSMISWPLVARNKVEDSQIMAPVEKFTESADETVKNCATKLKD
YWNTLEMSYRIPKRIAPEEPEPPKDVIDIYAQPKRSRFIDADDDGNKIVVKQQRKKRSMG
WYPRPATPPPEETPPMEGAPSWIEERLEKQKKNNEAVNSIIAQVAEEQAAAEAVAAERAR
LAAEEAKVEAERQKKSKDKDKDKDRKKSSQSSAEREANKEKRLQKLVGAIVVKCMSKYAK
SLEHEMFKKYAKELTEKIAEREKKTSAYKEGKLDSLSEEKITKIKKYAKEYITTKILRKI
GKSGQHRPRPSITPGAPSNSDGTPNSADLPSTMAELDVDEDMQTDSDDENGVAMDIGDDD
GWGPVAPKPPSMEVDVPNGKHDIVSDPRQRPPKVIGS
NT seq 2634 nt NT seq  +upstreamnt  +downstreamnt
atgtcccagacatatgtggaaaattattcttcatccttgacgacccagacaacggcggcg
acggcgacgacagggactatgaagaagagtaaaagtccaccgcttacaccactctcgagt
cgatgttcacaggcggaccagtcatcagtcacaaaatccgacctcaaacccgaacctgat
cttccacttgacctctgcttgccaccaagcacagcaaagcccatgtctgtcaagcaagaa
tcaccctcggcatcacgctcacactccccgtcaatcccagatgtgaaaccgcccgtgaag
gaggaggactatgggtcacccatgttggacgacacgaccccagcgagcggctcgtcgtcg
aaagggccttcaccgccggccacgacagcagcaggatcatcatcatcacgaaaggcagca
gcttctgctcctcagctcataggacaccttcctgtagctcgggaagaggctctagcttcg
tttacagaaatgcctgataattggtatcagtataagtcgttaggtcgctctagagagctc
ttagagagcatgacctgtgaatgcctctttgatccagattccgatcatcctgaagttgct
tgcgggcactcttcagactgtataaatcgactgactcaggtcgaatgtctgccaggtgac
tgtcgttgcggcgactattgtcaaaatcaacgcttccaaaaaaaggagtatgcgtcgata
gagattgtaaagacagagatgaaggggtatggtctcaggattgaaggggatattcaaaaa
gacaccttcatctacgaatatgtcggcgacgtcgtgaacaaccaatcattcaagaagcgg
atgcgggagtacgccaatgaaggcattcaacacttttacttcatgatgctccagaaagac
gaattcatcgacgcgaccaagaacggtggaataggtcgttttgccaaccatagttgtaat
cccaactgctatgtcgcaaagtggacagtcggtaccacggtccgaatgggtatatttgcc
aaacggaatatcaagaagcatgaagagttgacgttcaactacaatgtcgatcgttatggg
catcaagcacaaacatgttactgtggggagcctaattgtgttggcttcattggtggaaag
acacaaacagacgtgtctacgatggatgacttatacctggatgctcttggtattacagac
gacgccgatgtcgcggcgctgaagggaaataagaagaagaagggcaagaagattgacgat
ccggacttcatgcctcagatgaagcccatcgtagaaaaggaggtacccaaggtggtgcaa
gccttgcgacaagtccagagcaagaaggtactttccaaacttcttacgcgtataaagatc
accgaggacggtgcttcattacgacaaatcatgcgtttgcgtgggtttagtatcatgaag
aacatcttagaggattacgcagaggatttagacgtcattgccttggccttgcaatccatg
atatcttggccgttggtcgcccgcaacaaagtcgaggattcgcagatcatggcacccgtc
gagaaattcaccgaatctgctgatgaaacggtgaagaactgcgccaccaagctcaaggac
tactggaacacgcttgaaatgtcctatcgaatacccaagcgaatcgcacccgaggaaccc
gaacctcccaaagatgtaatagatatctatgcacaacccaaacgctctcgcttcattgac
gcagatgacgacggaaacaagattgtcgtcaagcagcagcgaaagaaacgttcaatgggg
tggtaccctcgccctgcaaccccgccaccagaggaaactccgccgatggaaggtgcccca
tcgtggatcgaggaacggctggagaagcagaagaagaataacgaggctgtgaatagtatc
atcgcgcaagtagcagaggaacaagctgctgcagaggcggtagcggcagaacgtgctaga
cttgctgcggaagaggctaaagttgaagctgagaggcagaaaaaaagtaaggataaagat
aaggataaggatcggaagaagagctctcagagtagcgcagagagggaggcgaacaaggaa
aagaggttgcagaagctcgttggcgctattgtcgtcaaatgcatgtccaagtatgcaaag
tcgctcgagcatgagatgttcaagaagtatgcaaaagagctgacggaaaagattgctgaa
cgagagaagaagacatctgcttataaggagggcaaactggattccctctctgaagagaag
attacaaagatcaagaagtacgctaaggaatacattaccaccaagattctccgcaagata
gggaaatccggccagcatagacctcgaccatccatcaccccgggtgcgccttccaactcg
gatggtactccaaactcggcagacttgccatctacaatggcggaactcgacgttgatgag
gacatgcagactgactcggacgacgaaaatggggttgcaatggatattggtgatgacgat
ggatggggaccggtcgcgcctaagccaccctcgatggaggttgatgtaccgaacgggaag
catgatatagtctcagatcctcgacagcgacctccgaaagtcattggctcgtag

DBGET integrated database retrieval system