KEGG   Moniliophthora roreri: Moror_7008Help
Entry
Moror_7008        CDS       T03137                                 

Definition
(GenBank) l-arabinitol 4-dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
mrr  Moniliophthora roreri
Pathway
mrr00040  Pentose and glucuronate interconversions
mrr00051  Fructose and mannose metabolism
mrr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mrr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Moror_7008
   00051 Fructose and mannose metabolism
    Moror_7008
Enzymes [BR:mrr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     Moror_7008
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: ESK96500
UniProt: V2XVA1
LinkDB All DBs
AA seq 388 aa AA seqDB search
MSTTTTVLAGNPALYDPRKVLDDPEFRILVQGEKPSSDANIAAFYNPAHEIHLVQKPRPK
PGPGQVMVHVRATGICGSDVHFWKHGQIGPTMVVRDECGSGHESAGEVVEVGEGVTQWKA
GDRVALENGVPCSQPSCDPCRLGQYNGCPNVVFFSTPPYHGTLTRWHLHPAQWLHRLPDN
VSLEEGALCEPLAVALAGIERSGLRLGDPTLICGAGPIGLVSLLSARAAGAEPIVITDLV
QSRLDFAKQLAPGIHTVLIDRTKSPQEQAEVIKEVAGGAVKVVLECTGFEGSIHTGIYST
QFGGKVFIIGVGRSEQTFPFMHLSANEIDVSFQYRYANQYPKAIRLVAGGLINLKPLVTH
RFALEDAVSAFHVAADPSSGAIKVQIQD
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgtccacgaccactactgtccttgctggaaatccggcactctatgaccctcgtaaggtg
ctcgatgatccagagttccgaatcctagtccaaggggagaagccctccagtgacgccaac
attgccgcattttacaaccctgcgcatgaaatacacctcgtccagaagcctcgtcccaaa
cctggacctggacaagttatggtgcacgtccgtgcgaccggtatttgtgggagcgacgta
catttctggaaacatggtcaaattggacccacgatggtggtcagagacgagtgtgggtct
ggtcatgaaagtgctggagaggttgtcgaagttggggagggtgtaacacagtggaaagcc
ggcgatcgtgttgctctcgagaacggtgttccatgctctcaaccttcttgcgatccctgt
cgcctgggtcagtacaatggttgcccgaatgtcgtcttcttctctactcctccttaccat
ggaactttgacccgatggcatcttcaccccgctcaatggctccatcgcctcccggataac
gtatcactcgaagagggcgctctctgcgagcccttagccgttgctttggcaggcattgaa
cgatcaggattacgccttggtgaccctacgttaatttgtggagctggaccaatcggcctg
gtatctctcctcagtgctagagccgctggagccgagccaatcgtcatcacggaccttgtg
caaagtcgacttgactttgcaaagcagctggctcctggcattcatacagtcctcattgac
cgcaccaaatcacctcaagagcaggccgaagtcattaaagaagttgctggaggtgcagta
aaggtcgtcctagaatgcaccggtttcgagggaagtatacatacgggaatatactcaacg
caatttggtggcaaagtgttcattattggtgtcggtagaagtgaacaaacgttccccttc
atgcacttgagtgccaatgagatcgatgttagcttccagtaccgatacgcgaaccagtat
ccaaaggccatccgtcttgttgcgggggggctcatcaatctcaagccacttgttacccat
cgtttcgcgttggaagacgcggtgtcggcgtttcacgttgcggcagacccatcttcagga
gccatcaaggttcaaatccaggattaa

DBGET integrated database retrieval system