KEGG   Moniliophthora roreri: Moror_8258Help
Entry
Moror_8258        CDS       T03137                                 

Definition
(GenBank) uracil-dna glycosylase
  KO
K03648  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
mrr  Moniliophthora roreri
Pathway
mrr03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:mrr00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    Moror_8258
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mrr03400]
    Moror_8258
Enzymes [BR:mrr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     Moror_8258
DNA repair and recombination proteins [BR:mrr03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     Moror_8258
 Prokaryotic type
     Moror_8258
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-ProteinID: ESK94273
UniProt: V2X545
LinkDB All DBs
AA seq 315 aa AA seqDB search
MPKHVEKDVETGMLQVANASRRTANAVVQTKLTRTLVVQTTGKKDSKRKSKDSSEANGLE
KLSPELHATIAAQLAGLEKDTMGESWYNALKGEFEKDYFRKLKTFLETETKTYTVFPPLN
NIYSWSRYTSLDAVKVVILGQDPYHDVGQAHGLSFSVLPPTKLPGSLKNIYKQIAVDVPS
FVIPKTAGDLSRLAKLGVLWLNTSLTVRAHKAASHSGKGWEILTAQAIKAVIARPDSNGV
VFMAWGLPAQKTCDKIGIDETKHLVLKSAHPSPLSAHRGFLGNGHFKRANEWLREKYGEG
AEIDWTVLNRYVLHL
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgccaaagcacgtagaaaaagacgttgaaactggcatgttacaagtcgcaaatgcctct
cgacggacagcaaatgcagtcgtacagacgaaattgacgcggacattggttgtacaaaca
accgggaagaaagacagtaaacgaaagtcaaaggactcgtctgaggccaatggtctagag
aaactctcaccagaactacatgcaacgattgcagcacaactggctggcttggagaaagac
actatgggagagagttggtataatgctctcaaaggagaatttgagaaggactactttcgc
aagctcaagacattcttggaaactgaaacgaaaacttacaccgtgtttcctccactcaat
aacatatactcctggtcgcgatatacatccctcgacgccgtcaaagtcgtcattcttggc
caagacccatatcatgatgtcggacaagctcatggtctttcgttctctgtccttccgccg
acgaaactacctggttccctgaagaatatctacaaacaaattgcggtagatgtaccctcg
ttcgtgatacccaaaaccgcgggggatctttctagactagcaaagctgggcgtgctctgg
ctgaacacttccttgaccgttcgtgcacacaaagcagcttctcattcaggcaaaggatgg
gagatccttactgctcaagccataaaggccgtgatcgctcgtccggatagtaatggcgtc
gttttcatggcatggggacttccagctcaaaaaacctgtgacaaaattggaatcgacgaa
actaagcaccttgttttaaagtcagcccatccatcacccctatctgcacaccgtgggttc
ttgggaaatggtcacttcaaacgggcgaatgagtggcttagagagaagtatggagaaggt
gctgagattgactggacagtactcaatcggtatgtgttgcatttgtga

DBGET integrated database retrieval system