KEGG   Muricauda ruestringensis: Murru_0596Help
Entry
Murru_0596        CDS       T01598                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
mrs  Muricauda ruestringensis
Pathway
mrs00010  Glycolysis / Gluconeogenesis
mrs00052  Galactose metabolism
mrs01100  Metabolic pathways
mrs01110  Biosynthesis of secondary metabolites
mrs01120  Microbial metabolism in diverse environments
mrs01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mrs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Murru_0596
   00052 Galactose metabolism
    Murru_0596
Enzymes [BR:mrs01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Murru_0596
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AEM69646
UniProt: G2PS56
LinkDB All DBs
Position
complement(638288..639475)
Genome map
AA seq 395 aa AA seqDB search
MMRIAKPSIFYCVLLLVFTTIGCKQNKKESQSKMETAKTESEQNPIEETIFGEMPDGTKV
KKFTLKNEAGMEVDVITYGGIITRWTAPDKQGSYEDIVLGFDSLEQYLDGSPYFGALIGR
YGNRIANGKFSLDGETYTLATNDGDNHLHGGEKGFDKVLWNATPKNTDAGAVLELTYISE
DGEEGYPGKLDVKVTYTLTDNNELDVQYEAVTDKPTVVNLTQHSYFNLSGKLSEPILDHE
IYLDADTYLPVDGGLIPTGELRAVAGTPFDFTAPKSIGKEIEADNEQLGLGGGYDHCWVL
NQGKEGFGLAASAYHPNTGRLLEVYTNEPGIQFYSGNFLDGTLPAKDGGAYGKRSGFCLE
TQHYPDSPNQVNFPSARLNPGETYSTRTMFKLSTK
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgatgaggatagccaaaccttctatattttactgtgttttacttttggtctttacaact
ataggctgtaagcaaaacaaaaaagaaagccagtcaaaaatggaaaccgcaaaaactgaa
agtgaacaaaaccccattgaagaaaccatatttggggaaatgcccgatggcacaaaagtg
aagaaattcactttgaaaaacgaagccggaatggaagtggatgtcatcacctatggtggt
atcattacccgttggacggcccccgataaacaaggaagctatgaggatatagtcctaggt
tttgatagtttggaacaatatcttgatggtagtccatactttggagcacttattggccga
tatggaaaccgtatagccaacgggaagttttctttggatggagagacctatacgctggcc
acaaacgatggcgacaatcaccttcacggaggagaaaaagggttcgataaagtactttgg
aacgctacaccaaaaaatacagatgctggggcggttttagagcttacctacatcagtgaa
gatggggaagaaggataccccggaaaattggatgtgaaggtaacctatacacttactgat
aataacgaattggatgttcaatatgaagctgtaacggataaacctaccgttgtgaatttg
acccagcacagttattttaacctatctgggaagctttccgaacctattttggaccacgaa
atttatttggatgccgatacatatcttcctgttgatggaggcctgattccaacaggggag
ttaagggctgtggctggaactcccttcgattttacggctcctaaatcaattggtaaagag
atagaggccgacaatgaacagttgggtcttgggggaggatatgaccattgttgggtgctc
aaccaagggaaagaaggctttggtttggcagcatcagcgtaccaccccaacacgggccga
ttgttagaggtgtataccaatgagcctggcatacaattttacagcggaaactttttggat
ggtacgttacctgcaaaagatggaggtgcctacgggaagcgctctgggttctgtttggaa
acacaacactatccagatagtcctaaccaagttaattttccttccgctaggttaaatccc
ggggaaacgtattctactaggaccatgttcaaactatcaaccaaataa

DBGET integrated database retrieval system