KEGG   Muricauda ruestringensis: Murru_1248Help
Entry
Murru_1248        CDS       T01598                                 

Definition
(GenBank) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
mrs  Muricauda ruestringensis
Pathway
mrs00240  Pyrimidine metabolism
mrs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mrs00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    Murru_1248
Enzymes [BR:mrs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     Murru_1248
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-ProteinID: AEM70291
UniProt: G2PNV6
LinkDB All DBs
Position
1348934..1349578
Genome map
AA seq 214 aa AA seqDB search
MFLENTVNPKEQFGWIEVICGSMFSGKTEELIRRLKRAQFAKQKVEIFKPIVDRRYHEEM
VVSHDSNEIRSTPVPAAANIRLLADDCEVVGIDEAQFFDDEIVTVCNDLANRGVRVVVAG
LDMDFKGNPFGPMPALMATAEYVTKVHAVCTRTGNLANYSFRKSLNDNLVLLGETEEYEP
LSRAAFYKAMLREKIKEMDVESEEVGTKKKKSNE
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgtttctcgaaaacacagtaaaccctaaagaacagtttggatggattgaggttatctgc
ggttccatgttttcgggaaagaccgaagaactgattcgacgactgaagcgggcacaattc
gccaagcaaaaggtggaaatatttaaacccattgtggatagacgctatcatgaggaaatg
gtggtctcccacgattccaatgaaattaggtccactcccgtaccggccgcagcaaacatt
cgccttttggcggatgattgtgaggtggtcgggattgacgaagcccaattttttgacgat
gaaattgttacggtttgtaacgatttggccaaccgaggcgtacgtgtagtggtcgctggt
ctggacatggattttaaaggaaacccctttggtcccatgcctgcattaatggcaacggca
gaatatgtgaccaaggtacatgccgtatgtacccgaacggggaatttggcgaactacagt
tttagaaaatcccttaacgataatttggtgcttttgggtgaaaccgaagagtacgagccc
ttgagcagagcagcgttttataaggccatgctgcgggaaaaaataaaggaaatggatgtg
gaatcggaagaagtgggcaccaaaaaaaagaaatccaatgagtaa

DBGET integrated database retrieval system