KEGG   Muricauda ruestringensis: Murru_1801Help
Entry
Murru_1801        CDS       T01598                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E1 subunit
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
mrs  Muricauda ruestringensis
Pathway
mrs00020  Citrate cycle (TCA cycle)
mrs00310  Lysine degradation
mrs00380  Tryptophan metabolism
mrs01100  Metabolic pathways
mrs01110  Biosynthesis of secondary metabolites
mrs01120  Microbial metabolism in diverse environments
mrs01130  Biosynthesis of antibiotics
mrs01200  Carbon metabolism
Module
mrs_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mrs_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mrs00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Murru_1801
  Amino acid metabolism
   00310 Lysine degradation
    Murru_1801
   00380 Tryptophan metabolism
    Murru_1801
Enzymes [BR:mrs01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     Murru_1801
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: AEM70841
UniProt: G2PJB4
LinkDB All DBs
Position
1968551..1971349
Genome map
AA seq 932 aa AA seqDB search
MDKYSFLNAAHTSFFAEQYEKYLTNPDNVEPSWRAFFQGFDFGLEGSLEDLGIESDKGGM
VVLSNGRKVEMPEALQKEFQVIRLIDGYRSRGHLFTETNPVRERRKYVPTLDIANFGLTE
GDLDTVFDAGKILGIGPAPLKEIIRHLESIYCDAIGVEYMYIRTPERIQWIQDWLNKNDN
HPNYTAEEKKNILRKLNEAVSFESFLHTKYVGQKRFSLEGGESLIPALDVIVEKAADQGV
KQFVVGMAHRGRLNVLTNIFGKSPKDIFSEFDGKDYEETIFDGDVKYHLGWTSKRETDSG
KMVNMNIAPNPSHLETVNSIVEGIARAKQDRDHGDNISEVLPILIHGDAAFAAQGVVYEV
IQMARLEGYTTGGTIHIVVNNQIGFTTNYLDARSSTYCTDVGKVTLSPVLHVNADDAEAV
VHATTFALEYRMRYKRDIFLDLLGYRKYGHNEGDEPKFTQPLLYKSISKHKNPRDIYAEK
LIAEGVIDENYVKELEEKYKNDLEEDLLDSRKIEKTRITPFMKDEWEGFEQVTEEVMLKP
MDTTYDLKKLDEVAQSITKLPEDKKFLRKLERLVEGRHKMYFEDNKLDWAMGELLAYGSL
VEEGYDVRMTGQDVERGTFSHRHAVIKTEMHEEEVVLLNEMGDNQNGKFHIYNSLLSEYA
VMGFDYGYAMASPKTLTIWEAQFGDFSNGAQIIIDQYLSSAEDKWKLQNGLVLLLPHGYE
GQGAEHSSARMERYLQLCAKDNMFVADVTTPANLFHLFRRQMKAKFRKPLVVFTPKSLLR
HPKVVSTKEEMANGGFQMVIDDAEAKAAKVKTLVFCTGKFYYDLLDKREELERDDVALVR
VEQLFPLPAKEMRSIIKKYKNADDIVWAQEEPRNMGAWSHMLMHLEEAKQFRVASRRFYG
APAAGSAVRSKRRHAQVLDYVFDKSKNNMQIR
NT seq 2799 nt NT seq  +upstreamnt  +downstreamnt
atggacaaatattcatttttaaatgctgcgcacacttcgttttttgcggagcaatacgaa
aaatatctaacgaatcccgataatgtagagcccagttggagggctttttttcaaggattt
gattttggtttggaaggttccctcgaagatttggggattgaatccgataaaggcggaatg
gtggtactttccaatggaaggaaagtggaaatgcccgaagcccttcagaaggaatttcag
gtaattcgccttattgatggttatcgttcccgtggacacctctttaccgaaacaaaccct
gtaagggaaaggagaaagtatgtacctactttggatatagccaactttggcctgaccgaa
ggagacttggacactgtttttgatgctggaaaaattcttggaataggtccagcccccctg
aaggaaattatacgacacctcgagagtatttattgtgatgcgataggagtggagtacatg
tatatacgtaccccggaacgtatccaatggattcaggactggctcaacaaaaatgacaac
caccccaattataccgcggaagaaaagaaaaacatccttaggaaattaaacgaggccgtt
tcttttgagagctttttacataccaaatatgtagggcaaaaacgattttcattggaaggt
ggcgaatcgttgattcccgctttggatgtgattgttgaaaaagcggcggaccaaggcgtg
aagcaatttgtggtgggtatggcccaccgagggcgtttgaatgttttgaccaatattttc
gggaaatcgccaaaagatatctttagtgagttcgatggtaaggattatgaggaaaccatc
tttgatggtgatgtaaaatatcacttggggtggacctctaaacgtgaaacggattcaggg
aaaatggtcaatatgaacattgccccgaacccttcgcacttggaaaccgtaaactccatt
gttgaaggtatagctagggctaagcaagatcgtgaccatggtgataacatctccgaagta
ctgccaattttaatccatggggatgctgcttttgctgcacagggagtcgtgtacgaagtg
attcaaatggctcgtttggaaggctacaccacaggcggtactatccatattgtggtgaat
aaccaaatcgggtttaccaccaactatttggatgctagatcctccacctattgtacagat
gttgggaaagtaaccctttccccagtattgcacgttaatgccgatgatgccgaagctgtg
gtgcatgccacgacctttgcgttggaatacaggatgcgctacaagcgcgacattttcttg
gatttattgggttatagaaagtatggccacaatgaaggtgatgaacctaagtttacccag
cccttgttgtataaatccatttccaagcataaaaacccgagggatatttacgcagagaag
ttgattgccgaaggggtaatcgatgagaattacgtaaaagagctcgaagaaaaatataag
aacgatcttgaggaggatcttttggattcccgcaaaatcgagaagacaaggataacccct
ttcatgaaagatgagtgggaagggtttgagcaggtgaccgaagaggtgatgctgaaacct
atggatactacttacgaccttaaaaagttagatgaggttgcccaaagcatcaccaaactt
ccagaggataaaaaattcctaagaaaattggaacgattggtggaaggtcgccataaaatg
tatttcgaggacaacaagctcgattgggccatgggagaacttttggcctacggatcattg
gtcgaggaaggttacgatgttcggatgacgggacaagatgtggaacggggaactttctcg
cacaggcatgccgtcatcaaaacggagatgcacgaggaagaggtggtgctgttgaacgag
atgggggacaaccaaaatggaaagttccatatctacaactcactactttcagaatatgcc
gtaatgggatttgattatggctacgccatggcaagtccaaaaactttgaccatctgggaa
gcgcagttcggggatttcagcaatggagcccagattataatagatcaatatctctcatca
gcggaggacaaatggaaattgcagaacggattggtgctcttgttgccccatgggtacgaa
ggtcagggtgctgaacactcttcggcacgtatggaaaggtacttgcaattgtgtgctaag
gacaatatgttcgtggcggatgtgaccacaccggccaacctgttccatctcttccgtaga
caaatgaaagccaagttccgtaagccattggtggtatttacaccgaaaagtttgttgagg
catcccaaggtggtttccaccaaggaggagatggccaatggaggtttccagatggtgatt
gacgatgccgaggccaaagccgccaaagtaaagacattggtgttctgtacgggcaaattc
tactatgaccttttggataaacgggaagagcttgaaagagatgatgtagctttggtacgc
gtggaacaactgttcccattgcctgcaaaagaaatgcgaagcatcatcaaaaaatataaa
aatgcagacgatattgtttgggcccaggaagaacccaggaacatgggagcgtggagccac
atgttgatgcatttggaagaagccaaacaatttcgggtggcttccagaaggttctatggt
gctcctgcagcaggtagtgccgttcgctcaaaaagacgtcatgcccaagtgttggactac
gtttttgacaagagcaaaaataatatgcaaataagataa

DBGET integrated database retrieval system