KEGG   Muricauda ruestringensis: Murru_2129Help
Entry
Murru_2129        CDS       T01598                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mrs  Muricauda ruestringensis
Pathway
mrs00620  Pyruvate metabolism
mrs00680  Methane metabolism
mrs01100  Metabolic pathways
mrs01120  Microbial metabolism in diverse environments
mrs01200  Carbon metabolism
Module
mrs_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:mrs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Murru_2129
  09102 Energy metabolism
   00680 Methane metabolism
    Murru_2129
Enzymes [BR:mrs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Murru_2129
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AEM71168
UniProt: G2PM71
LinkDB All DBs
Position
2336579..2339125
Genome map
AA seq 848 aa AA seqDB search
MQQTKRLEEFKKSVTNKFNIYNSLFLSLPYKNVENVGILIPLLLDQCEKGLKAGKEPQEI
LDVFFSNFVDIQDERERLDFMFRIIQYVERQVVLYDSVEDSAFPKLQEYSSSLTIKDYFE
LVNRTKNWDKVSKKLSTFSARIVLTAHPTQFYTPAVLDIIAELRSLIDEDRIHDIDVTLQ
QLGLTSLINAKKPTPLDEAKNIIYILRNTYYDAVGELYQYVKGNIKDEKFENYNLMKLGF
WPGGDRDGNPFVTADITKQVADELRLTLMKCYYNELKDLRKKLTFKGMQGHLNELSGKMY
QAMFDPNAAISYEGIIEHLSAVREELIEHYHGLYLNELDQFIDKVHIFKTHFATLDIRQD
HSKHKLVVETVLKKQGAIKESLDELKEKELVDLLLQGDYKLNPKDFDDDIVKDTILNIQN
LKAIQDKNGEDGCNRYIISNSEDIFSVLFVFGLFRWCGWDEKEITFDIVPLFETMNGMDA
SEEVMQTLFDIPQYRKHLERRRDIHTIMLGFSDGTKDGGYLKANWSILKTKETLSKVCKK
NGINAIFFDGRGGPPARGGGKTHRFYAAQTKDVANHEIQLTIQGQTITSTYGTKEQFIHN
SEQMLTAGISNNLFGKEHTISAAQRKLIEELSELSFGKYDSLKQHEKFIPYLENRSTLKY
YTKANIGSRPGKRGNKKQLTLSDLRAISFVGSWSQLKQNVPGYFGLGSALMQLKEEGRLN
EVKKLYKEVPFFKALMLNSMMSLAKTNFDLTSYMKDDPEFGDFWNILHDEFQLSKKMLLQ
ISGLKILMEDEAVSRESVKIREKIVLPLLVIQQNALYHITQNSEYKELYEKIVTRSLYGN
INASRNSA
NT seq 2547 nt NT seq  +upstreamnt  +downstreamnt
atgcagcagactaaacggttagaagagtttaaaaaatcggtaaccaataagtttaatatc
tataatagccttttccttagcttgccatacaagaacgtagaaaatgtgggaattcttatc
cctcttttgctcgatcagtgcgagaaagggctaaaggcaggcaaggaaccccaagagatt
ctggatgtattcttttccaacttcgtggatattcaagacgaacgggaacgattggatttt
atgttccgtatcattcaatacgtagagcgccaagtggtgctgtacgatagtgttgaggat
tccgcatttcccaaacttcaggagtacagtagttcgttgaccattaaggattattttgag
ttggtaaaccgtaccaaaaactgggacaaggtctccaaaaaattatcaacctttagtgcg
cgtattgttttaacggcacatcccacgcagttttacaccccggccgttttggacatcatt
gcagagcttcgttcgttgattgatgaagataggattcatgatattgatgtaaccctgcaa
caattgggtttgacctctttgatcaatgctaaaaaacctacgcccttggatgaggcgaaa
aatatcatctatattcttcgtaacacctattatgatgctgttggagaactctaccaatat
gtaaaaggcaacattaaggatgaaaagtttgagaactacaaccttatgaagcttggattt
tggccagggggtgaccgagatggaaacccatttgtaacggccgatatcaccaaacaagtg
gccgacgaactcaggctcaccttaatgaagtgctattacaacgaattgaaggacctccgt
aaaaaattgacctttaaaggaatgcaagggcatcttaatgagttgagcggtaaaatgtac
caggccatgttcgatcccaatgcggcaatttcctacgaaggcattattgaacatttaagt
gcagtgagagaagagctgatcgaacattatcacggcttatatttgaatgagttggatcag
tttatagataaggtccacatctttaaaacacattttgcaaccttggatatccgtcaagat
cacagcaaacataaattggtggtggaaaccgtgcttaaaaagcaaggggccatcaaggaa
agtttggatgaactcaaggaaaaggagttggtggatttattgctccaaggtgattacaaa
cttaatccaaaggattttgatgatgacattgtaaaagataccattctcaatattcaaaac
ttgaaagcaattcaggataaaaacggtgaagatggatgtaaccgttatatcatcagtaat
tccgaagatattttttccgtgttgttcgtatttggattgttcagatggtgcggttgggac
gagaaagaaatcacttttgatattgttccattgttcgaaacaatgaacggtatggatgct
tccgaggaagtgatgcaaaccttgttcgatattccacaatatagaaagcacctggaacga
agaagagatatccatacgatcatgctcggattttccgatggtaccaaagatggaggttac
ttaaaagccaactggtctattttgaagaccaaggaaaccttgagtaaagtctgcaagaaa
aacgggatcaatgccattttctttgatggtaggggagggccaccggcaaggggtggaggt
aagacccataggttctacgccgcccagaccaaggatgtggccaatcacgagattcagctt
accattcaagggcagaccattaccagtacctacggaaccaaggagcagtttattcataat
tctgagcaaatgctcacagccgggataagcaacaacctttttggtaaagagcacaccatt
tctgcagcgcaacgtaaacttattgaagaactttccgaactaagttttggaaagtatgat
tcgttgaagcaacacgaaaaatttattccgtatttagagaataggagtactttaaaatat
tataccaaagccaatataggtagtaggcctggtaaacgtgggaacaaaaagcagttgaca
ctatccgacctacgcgccatttcgtttgtaggttcttggagccagttaaaacagaatgtc
ccggggtattttgggttaggttccgcccttatgcagttaaaagaagaagggcgattgaac
gaggttaaaaaactttacaaagaggttcctttctttaaagcgttaatgctgaacagtatg
atgtccctggccaaaaccaattttgatttgaccagttatatgaaggatgatcccgaattt
ggggacttctggaacattttacacgatgaattccaattgtcaaaaaagatgttgctacag
atttccggtcttaaaattttgatggaagacgaagccgtatcaagagaatcggtgaaaatc
agggaaaagattgtattgccattgttggtgattcagcaaaatgccttgtatcacattacc
caaaattcagaatacaaagaactctacgaaaaaattgtaacgcgttcgttgtacggaaac
attaatgcaagtaggaactcggcttag

DBGET integrated database retrieval system