KEGG   Muricauda ruestringensis: Murru_2157Help
Entry
Murru_2157        CDS       T01598                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
mrs  Muricauda ruestringensis
Brite
Translation factors [BR:mrs03012]
 Eukaryotic Type
  Elongation factors
   Murru_2157
 Prokaryotic Type
   Murru_2157
Mitochondrial biogenesis [BR:mrs03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Murru_2157
Exosome [BR:mrs04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Murru_2157
  Exosomal proteins of breast cancer cells
   Murru_2157
  Exosomal proteins of colorectal cancer cells
   Murru_2157
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AEM71196
UniProt: G2PM99
LinkDB All DBs
Position
2362802..2363989
Genome map
AA seq 395 aa AA seqDB search
MAKETFDRSKPHLNIGTIGHVDHGKTTLTAAITTVLANAGLSETRSFDSIDNAPEEKERG
ITINTSHVEYQTENRHYAHVDCPGHADYVKNMVTGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGIPRIVVFLNKVDMVDDEELLELVEMEVRELLSFYEYDGDNGPVISGSALGALN
GEQKWVDTVMELMKAVDEWIEEPEREVDKDFLMPIEDVFTITGRGTVATGRIETGVANTG
DPVDIIGMGAEKLTSTITGVEMFRKILDRGEAGDNVGLLLRGIEKSDIKRGMVICKPGSV
KPHAKFKAEVYILKKEEGGRHTPFHNNYRPQFYLRTTDVTGNINLPDGVEMVMPGDNLTI
TVDLIQPVACSVGLRFAIREGGRTVGAGQVTEILD
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggaaacttttgatcgttccaaaccgcacttaaatattggtaccattggacac
gtggatcacggtaaaactacattgaccgctgctattaccactgtattggccaacgcaggt
ttgtctgaaacaagaagctttgattctattgacaacgctcctgaagaaaaagaaagaggt
attacaatcaacacttcgcacgttgagtaccaaacagaaaaccgtcactacgcacacgtt
gactgtcctggtcacgcggattacgtaaagaacatggttactggtgctgctcagatggac
ggcgctatcttggttgtagctgctacggatggtccaatgccacaaactcgtgagcacatc
ctattggggcgtcaggttggaattccacgtatcgttgttttcttgaacaaagttgacatg
gtggatgatgaagagcttttggagcttgttgaaatggaagtaagagaattgctttctttc
tatgagtacgatggtgacaatggtcctgttatttctggttctgcacttggtgctttgaac
ggtgagcaaaaatgggttgacacggttatggagttgatgaaagctgttgatgagtggatc
gaggagcctgagcgtgaagttgacaaagacttccttatgccaattgaagatgtattcacc
attacaggtaggggtactgttgctactggtcgtatcgaaactggtgttgccaatacaggt
gatcctgttgatatcatcggtatgggtgctgagaaattgacatctaccatcactggtgtt
gagatgttccgtaagattttggatagaggtgaagccggtgataacgtaggccttcttttg
agaggtatcgagaaatctgatatcaaaagaggtatggttatctgcaagccaggttctgtt
aagccacacgctaaatttaaagctgaggtttatatccttaaaaaagaagaaggtggtcgt
cacacaccattccacaacaactaccgtcctcagttctacttgagaactacagacgttact
ggtaacattaacttgcctgacggtgttgagatggtaatgccaggtgataacttgacaatt
accgtggatttgattcagcctgtagcttgtagtgtaggtctacgtttcgctatccgtgag
ggtggtagaacagtaggtgccggacaggttactgagattttggattaa

DBGET integrated database retrieval system