KEGG   Methanobrevibacter ruminantium: mru_2031Help
Entry
mru_2031          CDS       T01166                                 

Gene name
hisE
Definition
(GenBank) phosphoribosyl-ATP pyrophosphohydrolase HisE
  KO
K01523  phosphoribosyl-ATP pyrophosphohydrolase [EC:3.6.1.31]
Organism
mru  Methanobrevibacter ruminantium
Pathway
mru00340  Histidine metabolism
mru01100  Metabolic pathways
mru01110  Biosynthesis of secondary metabolites
mru01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mru00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    mru_2031 (hisE)
Enzymes [BR:mru01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     mru_2031 (hisE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-PH MazG
Motif
Other DBs
NCBI-ProteinID: ADC47881
UniProt: D3E0F7
LinkDB All DBs
Position
2589313..2589600
Genome map
AA seq 95 aa AA seqDB search
MDEKILREVYNVLESRRDSPIDSYTSNIMKDSDKKAEDKILEKIAEECGETIIASKNDEN
LVYESVDLIFHTLLLLVYKGVEFDEILEEFDRRRK
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atggatgaaaaaatccttagagaagtttataatgttttagaaagtcgtagggactctcct
attgattcatacacttctaatatcatgaaagacagcgataaaaaagcagaagacaagata
ttagaaaagatagctgaagaatgcggagaaaccattattgcttctaaaaatgatgaaaat
ttagtttatgagtctgttgacttaatatttcacacattgctccttttggtttacaaagga
gttgaatttgatgaaatcctagaagaatttgatagaagaagaaaataa

DBGET integrated database retrieval system