KEGG   Mycobacterium sp. JS623: Mycsm_00021Help
Entry
Mycsm_00021       CDS       T02423                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
msa  Mycobacterium sp. JS623
Brite
KEGG Orthology (KO) [BR:msa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:msa01001]
    Mycsm_00021
Enzymes [BR:msa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Mycsm_00021
Protein kinases [BR:msa01001]
 Serine/threonine kinases: Other
  Bacterial family
   Mycsm_00021
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH Pkinase_fungal Haspin_kinase Kinase-like RIO1
Motif
Other DBs
NCBI-ProteinID: AGB20486
UniProt: L0IQJ2
LinkDB All DBs
Position
complement(21556..22899)
Genome map
AA seq 447 aa AA seqDB search
MSPRVGVTLSGRYRLQRLIATGGMGQVWEGIDSRLGRRVAIKVLKGEYSTDPEFVERFRA
EARTVAMLNHPGIASVYDYGETDMDGEGRTAYLVMELVNGEPLNSVLKRTGRLSLRHALD
MLEQTGRALQVAHTAGLVHRDVKPGNILITPTGQVKLTDFGIAKAVDAAPVTQTGMVMGT
AQYIAPEQALGHDATAASDVYSLGVVGYESVSGKRPFTGDGALTVAMKHIKETPPPLPAD
LPPNVRELIEITLVKNPGMRYRSGGPFADAVAAVRSGRRPPRPNQAPSIGRASPAAVPSA
AQARAAADMTGRAPATAARVRPATGSHRSTPPPRRTFSSGQRALLWAAGVLGALAIVIAI
LIVLNAQDKKGQQTPPPTVTNTITETTPFQSPTAMPSWTDEGIFGHGGVEIGVTRLDASA
LPAMVQVTRLATEPGSRRQTVSEQTWQ
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgagtccccgcgtgggagtgacgctgtccggtcgctaccggctgcagcggctgatcgcc
accggcggtatgggccaggtgtgggagggcatcgactcgcggttgggccgccgtgtcgcg
atcaaggtgctcaaaggcgaatactccaccgaccccgaattcgtcgaacgcttccgggca
gaggcccgcacggtcgcgatgctcaaccaccccggcatcgccagcgtgtacgactacggc
gagacggatatggacggcgagggccgcaccgcctacctggtgatggaacttgtcaacggc
gagccgctcaactccgtgctcaaacgcaccggcaggctgtcgctgcggcacgcgctcgac
atgctcgagcagacgggccgcgccctgcaggtcgcccacaccgcgggcctcgtgcaccgc
gacgtgaagcccggcaacatcctgatcaccccgacgggacaggtgaagctcaccgacttc
ggcatcgccaaggcggtcgacgccgcgccagtgacgcagaccggcatggtgatgggcacg
gcccagtacattgcgccggagcaggcgctgggccacgacgcgaccgcggccagcgacgtg
tactcgctgggagttgttggctacgaatcggtttcgggcaagcgaccgttcaccggcgac
ggcgcactaacggtggcgatgaagcacatcaaggagacgccgccgccgctgcccgccgac
ctgcctcccaacgttcgagagctcatcgagatcacgctcgtgaagaaccccggcatgcgg
taccgctccggcgggccgttcgccgacgcggtggccgcggtgcggtccggtcgtcggcca
ccgaggcccaaccaagcgccgtcgatcgggcgggcatcgcccgccgcggtgccgtcagcc
gcgcaggcgagggcggccgcggacatgaccgggcgggcaccggcgaccgcggcaagggtt
cggcccgcgacaggcagtcatcgcagtactcccccgccacggcggacgttctcgtcgggt
cagcgcgcgctgctgtgggcggccggtgtgctgggtgcgctggcgatcgtcatcgcgatc
ctgatcgtgttgaacgcacaggacaagaagggccagcagacaccgcctccgacggtgacg
aatacgattaccgaaacaaccccgttccagtcgccgacggcgatgcccagttggaccgat
gagggcatcttcggtcatggtggagtggaaatcggggtaacccgactcgacgcgagtgcg
ctgcctgcaatggtgcaggtgacgcggttggccacggagccgggaagccggcgacagaca
gtttcagaacagacatggcaatga

DBGET integrated database retrieval system