KEGG   Mycobacterium sp. JS623: Mycsm_00214Help
Entry
Mycsm_00214       CDS       T02423                                 

Definition
(GenBank) succinate dehydrogenase and fumarate reductase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
msa  Mycobacterium sp. JS623
Pathway
msa00020  Citrate cycle (TCA cycle)
msa00190  Oxidative phosphorylation
msa00650  Butanoate metabolism
msa01100  Metabolic pathways
msa01110  Biosynthesis of secondary metabolites
msa01120  Microbial metabolism in diverse environments
msa01130  Biosynthesis of antibiotics
msa01200  Carbon metabolism
Module
msa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
msa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
msa_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:msa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mycsm_00214
   00650 Butanoate metabolism
    Mycsm_00214
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Mycsm_00214
Enzymes [BR:msa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Mycsm_00214
    1.3.5.4  fumarate reductase (quinol)
     Mycsm_00214
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer2 Fer4_17 Fer4_18 Fer4_7 DUF1126 Fer4_10
Motif
Other DBs
NCBI-ProteinID: AGB20672
UniProt: L0IRR4
LinkDB All DBs
Position
complement(236071..236823)
Genome map
AA seq 250 aa AA seqDB search
MAYQAKLRVWRGDDDGGALQDFSVDVNEGEVVLDIIHRLQQTQAGDLAVRWNCKAGKCGS
CSAEINGRPKLMCMTRMSTFDPAETITITPLRTFPVIRDLVTDVSFNYEKAREIPSFTPP
KDLQPGEYRMMQEDVNRSQEFRKCIECFLCQNTCHVVRDHEENKRAFAGPRYLMRQTELD
MHPLDTNERRAVQAQDENGLGFCNITKCCTEVCPEHIKITDNALIPLKERAADRKYDPVV
WLGDKLFRRG
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggcctatcaagcgaagctgcgggtgtggcgtggcgatgacgacggcggcgcgctgcag
gacttctccgtcgacgtcaatgagggcgaggtggtgctcgacatcatccaccggctgcag
cagacgcaggccggtgacctggccgtgcggtggaattgcaaggcaggcaagtgcggctcg
tgctcggccgagatcaacggcaggccgaagctgatgtgcatgacccggatgtcgacattc
gacccggccgagaccatcaccatcaccccgttgcggacgttccccgtcatccgcgacctg
gtaaccgatgtgtcgttcaactacgaaaaggccagggaaataccgtccttcacgccgccc
aaggatctgcagccgggcgagtaccggatgatgcaggaggacgtgaaccggtcgcaggag
ttccgcaagtgcatcgagtgcttcctgtgccagaacacctgccacgtggtgcgtgatcac
gaagagaacaagagggcgttcgccggtccgcgctacctgatgcgccagaccgaactggac
atgcatccgctggacacgaacgaacgccgtgcggtgcaggcgcaggacgagaacggcctc
ggcttctgcaacatcaccaaatgctgcaccgaggtgtgccccgagcacatcaagatcacc
gacaatgcgctgatcccgctcaaggaacgggcagccgatcgcaagtacgacccggtggtg
tggctcggcgacaagttgttccggaggggctga

DBGET integrated database retrieval system