KEGG   Mycobacterium sp. JS623: Mycsm_00215Help
Entry
Mycsm_00215       CDS       T02423                                 

Definition
(GenBank) succinate dehydrogenase/fumarate reductase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
msa  Mycobacterium sp. JS623
Pathway
msa00020  Citrate cycle (TCA cycle)
msa00190  Oxidative phosphorylation
msa00650  Butanoate metabolism
msa01100  Metabolic pathways
msa01110  Biosynthesis of secondary metabolites
msa01120  Microbial metabolism in diverse environments
msa01130  Biosynthesis of antibiotics
msa01200  Carbon metabolism
Module
msa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
msa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
msa_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:msa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mycsm_00215
   00650 Butanoate metabolism
    Mycsm_00215
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Mycsm_00215
Enzymes [BR:msa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Mycsm_00215
    1.3.5.4  fumarate reductase (quinol)
     Mycsm_00215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 DAO HI0933_like GIDA FAD_oxidored AlaDh_PNT_C Pyr_redox_3 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AGB20673
UniProt: L0IP82
LinkDB All DBs
Position
complement(236824..238737)
Genome map
AA seq 637 aa AA seqDB search
MAEVERHEYDVVVIGAGGAGLRAVIEARERGLKVAVVCKSLFGKAHTVMAEGGCAAAMGN
ANPKDNWQVHFKDTMRGGKFLNNWRMAELHAKEAPDRVWELETYGALFDRTKDGRISQRN
FGGHTYPRLAHVGDRTGLEIIRTLQQKIVSLQQEDKAEFGDYEARIKVFHECTITDLIKD
GDRISGAFGYWRESGRFILFEAPAVVMATGGIGKSYKVTSNSWEYTGDGHALALRAGATL
INMEFVQFHPTGMVWPPSVKGILVTEGVRGDGGVLKNSEGTRFMFDYIPPVFKGQYAESI
EEADQWLKDNDSARRTPDLLPRDEVARAINSEVKAGRNSPHGGVFLDIASRLPAEEIKRR
LPSMYHQFMELAEVDITKEAMEVGPTCHYVMGGIEVDPDTGAAKTPGLFAAGECSGGMHG
SNRLGGNSLSDLLVFGRRAGLGASDYVRGLSERPTVSDEAVAEAAKLALAPFDGPTNGDS
AENPYTLQLDLQDTMNSLVGIIRKAEEVTEALDKLTELRERFKRVQVEGHRQFNPGWHLA
IDLRNMLLVSECVAKAALERTESRGGHTRDDHPSMEAGWRKVLLVCRAEGAAVVPDVSIT
REDQVPMREDLLELVDIEELEKYFTPEELVNHPARRS
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagtcgaacggcacgaatatgacgtcgtcgtcatcggtgccggcggcgcgggt
ttgcgtgcggtcatcgaggcacgtgagcgcggtttgaaggtcgccgtggtctgtaagtcg
ttgttcggcaaggcgcacaccgtgatggccgaaggcggctgtgcggccgcgatgggcaat
gccaacccgaaggacaactggcaggtccacttcaaagacaccatgcgcggcgggaagttc
ctcaacaactggcggatggccgaactgcacgccaaggaggcaccagaccgcgtctgggag
ctggaaacctacggcgcactgttcgaccgcaccaaggacgggcgcatcagccagcggaac
ttcggcggccacacctacccgcgactggctcacgtcggcgaccgcaccgggctggaaatc
atccgcaccctgcagcagaagatcgtctcgctgcagcaggaggacaaggccgagttcggc
gactacgaggcccgcatcaaggtgttccacgagtgcacgatcaccgacctgatcaaggac
ggtgaccgcatctccggtgccttcggctactggcgcgaaagcggacgcttcatcctgttc
gaggcgcctgccgtggtgatggccaccggcggaattggcaagtcctacaaggtgacatcg
aactcgtgggagtacaccggcgacgggcacgcactcgcgctgcgcgcgggcgcgacgctg
atcaacatggagttcgtccagttccatccgaccggcatggtctggccacccagcgtgaag
ggcatcctcgtcacagagggtgtgcgcggcgacggcggggtgctgaaaaactccgagggc
acccggttcatgttcgactacatcccaccggtgttcaaaggtcagtacgccgagagcatc
gaagaggccgaccagtggctcaaggacaacgactcggcgcgtcgcacccccgacctgctg
ccccgcgacgaggtggcccgcgccatcaactccgaggtgaaagccgggcgtaactcgccg
cacggcggcgtgttcctcgacatcgcgtcgcggctgcccgccgaggagatcaagcgcagg
ctgccgtcgatgtatcaccagttcatggagctggccgaggtcgacatcaccaaggaggcg
atggaggtcgggccgacgtgccactacgtgatgggtggcatcgaggtcgatcccgatacg
ggtgcggccaagacgccggggctgttcgccgccggtgaatgctccggtggcatgcacggc
tcgaaccggctgggcggcaactcgctgtcggacctgctggtgttcggccgccgcgccggg
ctcggtgcgtccgactacgtgcgggggctgtccgagcggccgacggtgtccgacgaggcc
gtggccgaggccgccaagctggccctcgcgccgttcgacgggccgaccaatggcgacagc
gccgagaacccgtacaccctgcaactcgacctgcaggacacgatgaactccctggtcggc
atcatccgcaaggccgaggaagtcaccgaggcgctggacaagctgaccgagctgcgcgag
cggttcaagcgcgtgcaggtggagggccaccgtcagttcaacccgggctggcatttggcc
atcgacctgcgcaacatgctgctcgtcagcgaatgcgtggccaaagccgcgttggaacgc
accgagagccgcggcggccacacccgcgacgaccatccgtcgatggaggcgggttggcgc
aaggttctgctggtgtgccgcgcagaaggtgccgccgtcgtccccgacgtcagcatcacc
cgcgaggatcaggtgccgatgcgtgaggacctcctcgagctcgtcgacatcgaagagctc
gagaagtacttcaccccagaagaactcgtcaaccacccggcaaggagaagctga

DBGET integrated database retrieval system