KEGG   Mycobacterium sp. JS623: Mycsm_01089Help
Entry
Mycsm_01089       CDS       T02423                                 

Definition
(GenBank) Zn-dependent alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
msa  Mycobacterium sp. JS623
Pathway
msa00010  Glycolysis / Gluconeogenesis
msa00071  Fatty acid degradation
msa00350  Tyrosine metabolism
msa00625  Chloroalkane and chloroalkene degradation
msa00626  Naphthalene degradation
msa01100  Metabolic pathways
msa01110  Biosynthesis of secondary metabolites
msa01120  Microbial metabolism in diverse environments
msa01130  Biosynthesis of antibiotics
msa01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:msa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mycsm_01089
  Lipid metabolism
   00071 Fatty acid degradation
    Mycsm_01089
  Amino acid metabolism
   00350 Tyrosine metabolism
    Mycsm_01089
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Mycsm_01089
   00626 Naphthalene degradation
    Mycsm_01089
Enzymes [BR:msa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Mycsm_01089
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C TrkA_N
Motif
Other DBs
NCBI-ProteinID: AGB21512
UniProt: L0IU69
LinkDB All DBs
Position
1104906..1105967
Genome map
AA seq 353 aa AA seqDB search
MTQTLGAHTASDVTESMRAAVVTEFGGPLQVEDLDLPTPGYGEALVKLETSGVCHTDLHA
AHGDWPVKPRPPFIPGHEGYGTVVAVGEGVDDLEVGDKVGNAWLWSACGTCEYCRTGWET
LCESQKNGGYSVNGSFGSYMLVNTAYAARIPENADPLEVAPILCAGVTVYKGLRVTDARP
GQWVAISGIGGLGHVAVQYARAMGLRVVAIDVDDSKLALATRLGAEVVVNARTSDVVAEV
QKATGGVHGVLVTAVHPQAFGEAIGLARRGGTIVFNGLPPGDFPAPIFDIVLKGLTIRGS
IVGTRQDMAEALDFYARGLIHPTVQSARLDDINEVFGRMERGQIDGRVVIDYR
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgacccaaacccttggcgctcacacagcgtccgacgtcaccgagagcatgcgcgcagcc
gtcgtcaccgaattcggcggacccctacaggtcgaagacctcgacctgccaacgccgggc
tacggcgaggcattggtcaaactcgagacctccggtgtgtgccacaccgatctccatgcc
gcgcacggagattggcccgtcaagccgcgaccgccgttcatccccggccatgagggctac
ggcaccgtcgtggcagtcggcgagggcgtcgacgacctcgaggtcggcgacaaggttggc
aacgcctggctgtggtcggcgtgcggcacgtgcgagtactgccgcaccggctgggaaacc
ctctgcgagagccagaaaaacggcggctacagcgtcaacggcagtttcggcagctacatg
ttggtgaacaccgcctacgcggcacgcatccccgagaacgcagacccgctcgaggtcgcc
ccgatcctgtgcgcgggcgtcaccgtctacaagggcctcagggtgaccgacgctcggccc
ggacaatgggtggccatctccggcatcggcggactcggccacgtcgcggtgcagtacgcc
cgcgcgatgggactgcgcgtcgtcgcgatcgatgttgatgactccaaacttgccttggcc
acccgacttggcgcggaggtcgtcgtcaacgcccgcacctccgacgtcgtcgccgaagtg
cagaaggccacgggtggtgtgcacggggtgctcgtcacagcggtgcacccacaggcgttc
ggcgaggcgatcgggctggcgcggcgtggcggcacgatcgtgttcaacggccttccgccg
ggcgactttccggcgcccatcttcgacatcgtgctcaaaggtctgacgatccgcggttcg
atcgtcggcacccgccaggacatggccgaggcgctggacttctacgcccgtggcctgatc
catccgacggtgcaaagcgcgcgcctggacgacatcaatgaggtgttcggccgaatggaa
cgcggccaaatcgacgggcgtgtcgtcatcgactaccggtag

DBGET integrated database retrieval system