KEGG   Mycobacterium sp. JS623: Mycsm_02866Help
Entry
Mycsm_02866       CDS       T02423                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
msa  Mycobacterium sp. JS623
Pathway
msa00620  Pyruvate metabolism
msa00680  Methane metabolism
msa01100  Metabolic pathways
msa01120  Microbial metabolism in diverse environments
msa01200  Carbon metabolism
Module
msa_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:msa00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mycsm_02866
  Energy metabolism
   00680 Methane metabolism
    Mycsm_02866
Enzymes [BR:msa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Mycsm_02866
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 KfrA_N
Motif
Other DBs
NCBI-ProteinID: AGB23192
UniProt: L0IXX6
LinkDB All DBs
Position
2807109..2809904
Genome map
AA seq 931 aa AA seqDB search
MAEGPDVALAPIGSVRRTQVGREATEPMREDIRLLGTILGDTVREQNGEEVFDLVERARV
ESFRVRRSEIDRAELARMFDGIDIHQAIPVIRAFSHFALLANVAEDIHRERRRAVHVAAG
EPPQNSSLAATYLKLDSAELDSATVADALRGALVAPVITAHPTETRRRTVFDTQHRITEL
MRLRLHGQTETDDGRNINLELRRHIFTLWQTALIRLSRLKIQDEIKTGLRYYQAAFLEVI
PKVNAEVRTALQARWPEADLLELPILRPGSWIGGDRDGNPNVTADVVRQATGRASYTAFE
HYFTEISALEQELSMSARLVKVSDDLAALADKCHEPARADEPYRRALRVIHGRLTATAGE
ILDSQPEHELDLGLQRYVTPAELLADLDVIDHSLRSNGSGVLADDRLAQLREAVRVFGFH
LSGLDLRQNSDVHEEVVAELLAWAGVHADYQSLSEPERVELLAAELATRRPLTKDDAELS
ELARKELDIVAAAARAVHVYGPHAIPNYIISMCQSVSDMLEAAILLKEVGLLDASGDEPY
APVGIVPLFETIDDLQRGSSILEAVLDLPLYRAVVTARGDSQEVMLGYSDSNKDGGYLAA
NWALYRAELDLVESARKTGIRLRLFHGRGGTVGRGGGPSYDAILAQPPGAVNGSLRITEQ
GEVIAAKYAEPRVAHRNLETLLAATLEATLLDVEGLGDAAEPAYEVLDELAARAQRAYAE
LVHVTPGFVEYFKASTPVSEIGALNIGSRPTSRKPTTSISDLRAIPWVLAWSQSRVMLPG
WYGTGAAFEGWIAEGDGRLEVLQDLYHRWPFFRTVLSNMAQVLSKSDMGLAARYSELVED
EALRQRVFDKIVDEHDRTIRMHKLITGQDDLLADNPALARSVFNRFPYLEPLNHLQVELL
RRYRSGDDDELVQRGILLTMSGLATALRNSG
NT seq 2796 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaggacccgatgtcgcgctcgccccgatcggctcggtgcgtcgtacccaggtg
ggtcgcgaggcaaccgagccgatgcgggaggacatccggctgcttggcacgatcctcggc
gacacggtgcgtgagcagaacggcgaggaggtcttcgacctcgtcgagcgggcccgcgtc
gagtcgttccgggtgcgacgctcggagatcgatcgggccgagttggcccgcatgttcgac
ggcatcgacatccaccaggccatcccggttatccgggcgttctcgcatttcgcgctgctt
gccaacgtcgccgaggatatccatcgtgaacgccgccgcgccgttcacgtcgccgcgggc
gaacctccgcagaacagcagcctggccgctacgtacctgaaactcgactccgcggaactg
gattcggccacggttgccgacgcactgagaggcgcgctggtcgctccggtgatcaccgcg
catcccaccgagacgcgccggcgcacggtgttcgacacccaacatcgcatcaccgaactg
atgaggctgcggctgcacggccagaccgagaccgacgacggtcgcaacatcaacctggag
ctgcgtcgccacatcttcacgctgtggcagaccgcgctgattcggttgtcgcggttgaag
attcaggacgaaatcaagacggggttgcgctactaccaggcggctttcctggaagtgatc
ccgaaggtcaacgcggaggtacgtaccgcactgcaggcccgctggcccgaggcggacctg
ctcgagctgccgattctgcggccgggctcgtggatcggtggtgaccgtgacggcaatccc
aacgtcaccgcggacgtggtccggcaggccaccggcagagcttcctacaccgcgttcgaa
cattacttcaccgaaatcagtgcgctggaacaggaattgtcgatgtcggcgcggctggtc
aaggtcagcgacgacctcgcggcattggccgacaagtgtcacgagccagcacgtgccgac
gaaccgtatcgccgcgcattgcgcgtcatccacggccggctcaccgcgactgcaggtgag
atcctggacagccagcccgagcacgagctcgatcttggcctacagcgctacgtgacgccg
gccgaactgctggccgacctcgatgtcattgatcactcgttgcgttccaacggcagcggg
gtgctcgccgacgaccggctggcgcagctgcgagaggccgtgcgtgtctttggctttcac
ttgtccggcctggatctgcgtcagaactccgatgtgcacgaagaagtcgttgccgaactg
ctggcctgggcgggggtgcacgcggactaccagtcgttgtctgagccggagcgcgttgag
ctgctggccgccgagttggcgacccgtcgaccactgacgaaagacgatgccgaattgtcg
gagctggctcgcaaggagttggacatcgttgccgccgccgcgcgagccgttcatgtctat
gggcctcatgcgatacccaactacatcatctcgatgtgccagtcggtttcggacatgctc
gaggcggccatcctgctaaaggaggtcgggctgctggatgcctcgggcgacgagccgtat
gcgccggtcgggattgtgccgctcttcgagacgatcgacgacttgcagcggggctcgtcg
attcttgaagcggtgcttgatcttcccctctaccgcgctgtcgtgactgcgcgcggcgac
agccaggaagtgatgcttggttattcggactcgaataaggacggcggttatctcgcggcc
aactgggcgctgtatcgtgccgagctcgatctggtcgagtcggcccgcaagaccggaatt
cggttgcgactctttcatggtcgtggcggcacggtcggccgcggaggtgggccgagctat
gacgccattctcgcccaaccgcctggcgcggtgaacgggtcgcttcggatcaccgagcag
ggcgaagtgatcgccgccaagtacgccgaaccgcgggtcgcgcatcgcaacctcgagacg
ctgttggcggcgacgttggaagccacgctgctcgacgtcgaaggcctcggcgatgcggcc
gagccggcctacgaggtgctcgatgaacttgctgcccgtgcccagcgtgcgtacgccgaa
ttggtgcacgtgacaccgggtttcgtcgagtatttcaaggcgtcgacgccggtcagcgag
attggtgcgctcaacatcggcagcaggccgacgtcgcgtaaaccgaccacgtcgatttcg
gatctgcgtgctatcccctgggtgctggcgtggagccagtcgcgggtgatgctgcccggc
tggtacggcaccggggccgcgttcgaaggctggatcgccgaaggcgacggcaggctggaa
gtgctgcaggacctctatcatcgatggccgttcttccgcaccgtcctctcgaatatggcg
caggtgttgtccaagtcggacatgggactggccgcgcgctactcggaactcgtcgaggac
gaggcgttgcgccagcgggtgttcgacaagatcgtcgacgaacacgaccgcacgatccgc
atgcacaagctcatcaccggccaggacgacctgcttgccgacaacccggcgctggcgcgg
tcggtgttcaaccggtttccgtatctggaaccgctgaaccatttgcaggtcgagctgctg
cggcgataccggtccggtgacgacgacgaactcgtccagcggggcatcctgctgacgatg
agtgggctggctaccgcgttacgcaacagtggatag

DBGET integrated database retrieval system