KEGG   Mycobacterium sp. JS623: Mycsm_04228Help
Entry
Mycsm_04228       CDS       T02423                                 

Definition
(GenBank) sugar phosphate isomerase/epimerase
  KO
K03335  inosose dehydratase [EC:4.2.1.44]
Organism
msa  Mycobacterium sp. JS623
Pathway
msa00562  Inositol phosphate metabolism
msa01100  Metabolic pathways
msa01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:msa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Mycsm_04228
Enzymes [BR:msa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.44  myo-inosose-2 dehydratase
     Mycsm_04228
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2 AP_endonuc_2_N
Motif
Other DBs
NCBI-ProteinID: AGB24479
UniProt: L0IZH9
LinkDB All DBs
Position
4148220..4149092
Genome map
AA seq 290 aa AA seqDB search
MKIAGAPISWGVCEVPGWGYQLDPQRVLAEMRDVGLAATELGPEGFLPSDPAELTALLDS
FGLSCVGTFAPVLLHDAHHDPLPDIADPVDALLACGAEVLVLAAATGTDGYDSRPALDDD
QWATLLANLDRLAAAAAKRGVLAVLHPHVGTMVETRDDVDRVLAGSQIKLCLDTGHLLIG
GTDPLQLAREVPDRIAHTHLKDVDAALAARVQAGELTYTEAVRDGMYTPLGGGDVDIAGI
VTALRSNGFDGWFVMEQDTILDSVPTDEGPLRDVRTSVEYISEVGRSVPV
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
gtgaagatcgccggtgcgccgatttcctggggtgtgtgcgaagtgccgggttggggctat
cagctcgacccgcaacgcgtccttgcagagatgcgcgacgtgggtttggccgcaacggaa
ttggggcccgagggcttcctgccgtccgatcccgccgagctgaccgcgctgctcgactcg
ttcgggctgagctgtgtgggcaccttcgcgccggtcctgctgcatgacgcccaccatgat
ccgctgcccgacatcgccgacccggtcgacgcgctgctggcatgcggcgcagaagttctc
gtgctcgccgcggcgaccggcaccgacggctacgattcccgcccggcgctcgacgacgac
caatgggcaacgctgctggccaatctcgaccggctggcggcagcggcggcgaagcgaggc
gtgctggccgtgctccatccgcatgtcggcacgatggtagagacccgcgatgacgtcgac
cgcgtgctggccggttcccagatcaagctgtgcctggacaccgggcacctgctgatcggc
ggcaccgacccgctgcagctcgcccgcgaggtgcctgaccgcatcgcccacacccacctc
aaggatgtcgatgccgcgctggccgctcgtgttcaggccggcgagctgacttacaccgag
gccgtgcgcgacggtatgtacaccccgctcggcggtggcgacgtcgacattgcaggcatc
gtcacagcattgcgcagcaacggttttgacggctggttcgtgatggagcaggacaccatt
ctcgattcggtgccgaccgacgagggaccgctgcgcgatgtgcggaccagtgtcgagtac
atcagcgaggtggggcggtcagttccggtatga

DBGET integrated database retrieval system