KEGG   Mycobacterium sp. JS623: Mycsm_05103Help
Entry
Mycsm_05103       CDS       T02423                                 

Definition
(GenBank) Zn-dependent alcohol dehydrogenase
Organism
msa  Mycobacterium sp. JS623
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 2-Hacid_dh_C ADH_N_2 Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: AGB25311
UniProt: L0J4Z6
LinkDB All DBs
Position
5049657..5050688
Genome map
AA seq 343 aa AA seqDB search
MRAERFYADSKTIAVEDVPIPEPGPGEVLVKVAFCGICHSDLSLINGTFPAQLPVVTQGH
EASGTIAKLGPDVTGWSEGDRVIVAAGRPCTTCPKCRRGDIPNCQRLQLMAFAYDGAWAE
YTVAQAVGLTRVPENMLLEQAAILADAVSTPFGAVVRTGRVGIGESVGVWGVGGVGTHIV
QLARLVGAAPVLAIDIKPAVLDRALELGADHALDASDPALRDKIAEITGGRMLDVAFDAV
GLKSTFEQALDCITVGGRLVGVGMSAEAPSVGPTSMFGLTQKHVVGHLGYQNVDIETLAT
LVSLGRLDLSRSISDVVSLEDVRVGIEKLERQEGNPIRILVQP
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgccgagcgtttctacgctgactccaaaaccattgcggtggaggatgttccgatt
ccagagccgggtcccggcgaggtgctcgtcaaggtcgcgttctgcggcatctgccattcc
gatctcagcctgatcaacggcaccttccccgcacagctgccggtggtgacgcagggccat
gaggcgtcgggcactatcgccaagctgggccccgatgtcaccggctggtcagagggcgac
cgcgtgatcgtcgctgcaggcaggccctgtacaacatgcccgaaatgccggcgcggcgac
atccccaattgccagcggcttcagttgatggccttcgcctatgacggcgcgtgggccgag
tacacggtcgcgcaggccgtcggcctgacccgggtgcccgagaacatgctgctcgagcag
gccgcgatcctggccgacgcggtgtccacgccgttcggcgcggtggtgcgcaccgggcgg
gtgggcatcggagaatcggtcggcgtgtggggtgtcggcggcgtcggcacgcacatcgtc
caactggcccgactcgtcggtgccgcgccagtgctcgcgatcgacatcaagcccgccgtg
ttggaccgagcgctggaattgggcgccgaccacgcgctggacgcaagcgaccccgcgctg
cgcgacaagatcgccgagatcaccggcggcagaatgttggatgtggctttcgatgcggtc
ggtctgaagtcgacgttcgagcaggcactcgactgcatcaccgttggcgggcgtctcgtc
ggcgtggggatgagcgccgaggctccgagcgttggtccaaccagcatgttcggactgacg
cagaagcacgtggtgggccacctgggctaccagaatgtcgacatcgaaacactggccacc
ttggtgtccctgggccggcttgatctgtcgcgctccatcagcgacgtcgtctccctggag
gacgtcagggtcggcatcgagaagctggaacgccaggagggcaacccgattcggatcttg
gtgcagccgtga

DBGET integrated database retrieval system