KEGG   Mycobacterium sp. JS623: Mycsm_05316Help
Entry
Mycsm_05316       CDS       T02423                                 

Definition
(GenBank) DNA ligase D/DNA polymerase LigD
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
msa  Mycobacterium sp. JS623
Pathway
msa03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:msa00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    Mycsm_05316
Enzymes [BR:msa01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Mycsm_05316
DNA repair and recombination proteins [BR:msa03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Mycsm_05316
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C RNA_ligase Thr_synth_N DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: AGB25514
UniProt: L0J2H8
LinkDB All DBs
Position
complement(5274419..5276704)
Genome map
AA seq 761 aa AA seqDB search
MVDRFGRVRLTNPDKVLYPATGTTKAEVFDYYVNIAEVMIPHIAGRAVTRKRWPNGVDEA
SFFEKQLASSAPEWLDRASITHKSGTTTYPLIDTVEGVAWLAQQASLEVHVPQWRFVVGG
QDGRANEQGPATRIVFDLDPGAGVSFRQLCTVAHEVRDLLTDIGLTTFPLTSGSKGLHLY
VPLEEPISSHGASVLARRVAQQLEKTMPKQVTATMTKSLRTGKVFLDWSQNNAAKTTIAP
YSLRGREHPTVAAPRTWDEIADPKLRHLRFDEVLERVDRDGDLLADLDESVPLTDQLTKY
RSMRDASKTPEPVPKTPPKAGDNNLFVIQEHHARRLHYDLRLERNGVLVSWAVPKNLPDT
PAVNHLAVHTEDHPLEYLTFHGTIPKGEYGAGQMIVWDTGTYETEKFNDVPPDGPAKGGE
VIVTLHGKKIEGRYALIQTDGKNWLAHRMKEQQQPQAGDLAPMLATEGSVENLKSSQWAF
EGKWDGYRVIVEANRGRLSARSRRGRDVTGEYPQFEALAADLADHHVILDGEAVALDDKG
VPSFSEMQNRARSTRVEFWAFDILQLDGRSLLRAKYSDRRRLLEALAEGGGIIVPDTLPG
DGTEAMEHARKHRWEGVIAKKRDSTYQPGRRSSSWIKDKIWCTQEVVIGGWRQGEGGRSS
GIGALMLGIPEDGGLHFAGRVGTGFTEKELTKLKGILKPLHTDESPFNTRLPTQDAKNVT
FVRPELVGEVRYSERTSDGRLRQPSWRGLRPDKVPDEVRWE
NT seq 2286 nt NT seq  +upstreamnt  +downstreamnt
gtggtggatcgattcggccgggtcaggctcaccaacccggacaaggtgctgtacccggcg
acggggaccaccaaggccgaggtcttcgactactacgtcaacatcgccgaagtgatgatc
ccgcacatcgcggggcgcgccgtcacccgcaagcgctggcccaacggcgtcgacgaggca
tcgttcttcgaaaagcagctcgcgtcgtcggcccccgagtggctcgaccgcgccagcatc
acacacaaatccggcactaccacctatccgctcatcgacaccgtcgagggcgtcgcgtgg
ctggcccaacaggcctcgctggaagtgcatgtcccgcagtggcgattcgtcgtgggcggg
caggacgggcgggcgaacgagcaggggcccgccactcgaatcgtattcgacctcgatccg
ggcgcgggggtgagttttcgtcagttgtgcacggtggcccacgaagtccgtgatctgctc
accgacatcgggctcacgactttcccgctgaccagcggtagcaagggtctgcacctttat
gtgccgctcgaggagccgatcagctcgcacggcgcatcggtgttggctcgtcgagtggcc
cagcagctggaaaagaccatgcccaaacaggttacggcgaccatgaccaagagcctgcgc
acaggcaaggtctttctcgactggagccagaacaacgctgcaaaaacaaccatcgcgccg
tattcgcttcgtggacgtgaacatccgacggtggcagcgccacgcacctgggatgaaatt
gccgaccccaaactgcgacatctgcgtttcgatgaggtgctggagcgggtcgacagggac
ggcgacctgctggccgatctcgacgagagcgtgccgctgaccgatcagctgaccaaatac
cgcagcatgcgcgacgcgtcgaaaaccccggagccggttccgaaaacaccgccaaaggcg
ggtgataacaacctattcgtaatccaggagcaccacgcccgcaggcttcactatgacctg
cgcctggagcgaaacggtgttctggtgagctgggcagtgcccaagaatttgcccgacact
cctgcggtgaatcaccttgccgtgcacaccgaggaccatccgctggagtacttgacattc
cacggcaccatcccgaagggggagtacggcgcgggccagatgatcgtctgggacaccggg
acatacgagaccgagaagttcaacgacgtacccccggacggccccgccaagggtggggaa
gtgatcgtcacgttgcacggcaagaagatcgagggccgttacgcgctgatccagaccgac
ggcaagaactggctggcgcaccggatgaaggaacagcagcagccacaagcaggcgatctc
gcgccgatgctggcgacggaagggtccgtcgagaatctcaagtcgtcgcaatgggcgttc
gaaggtaaatgggatggctatcgcgtcatcgtcgaagcgaaccgcgggcggctcagcgcg
cgctcccgacgcggccgcgacgtcactggtgaatatccgcaattcgaagcgcttgcagcc
gatctcgccgaccatcacgtgatcctcgacggtgaagccgtagcgctcgatgacaagggc
gtgccgagtttcagcgagatgcagaaccgagcacggtccacgcgcgtcgagttttgggcg
ttcgacatcctgcagctcgatggccgatcgttgttgcgcgccaagtactcagaccgtcgc
cggctgctcgaagcgttggccgagggcggcgggatcatcgtgcccgacacgctgcccggt
gacggcaccgaagcaatggagcacgcccgcaaacaccgctgggaaggtgtgatcgcaaag
aagcgcgactccacgtaccaacccggccgacgctcgtcgtcgtggatcaaggacaagatc
tggtgcacgcaggaagtggtgatcggtggctggcggcaaggcgagggtggccgctccagc
ggtatcggcgcactgatgctgggcattcccgaagacggcgggctgcatttcgccggccgg
gtcggcaccgggttcaccgaaaaggaactgaccaagctcaagggcatcctcaaaccgctg
cacaccgacgaatcgccgttcaacacacggcttcccactcaggacgccaagaacgtcacg
ttcgtccgacccgaactggtcggcgaggtgcgttacagcgaacgcacctcggatggccgg
ctgcgtcagccgagttggcgcgggctgcgcccggataaagtccctgacgaagtgcgctgg
gaatga

DBGET integrated database retrieval system