KEGG   Mycobacteroides saopaulense: MYCSP_00180Help
Entry
MYCSP_00180       CDS       T05445                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
msao  Mycobacteroides saopaulense
Brite
KEGG Orthology (KO) [BR:msao00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:msao01001]
    MYCSP_00180
Enzymes [BR:msao01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     MYCSP_00180
Protein kinases [BR:msao01001]
 Serine/threonine kinases: Other
  Bacterial family
   MYCSP_00180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Pkinase_fungal Seadorna_VP7 WaaY Kinase-like YscJ_FliF
Motif
Other DBs
NCBI-ProteinID: ALR10150
LinkDB All DBs
Position
complement(34831..36717)
Genome map
AA seq 628 aa AA seqDB search
MTTPQHLSDRYELGEILGYGGMSEVHLARDQRLNRDVAIKVLRADLARDPSFYLRFRREA
QNAAALNHPAIVAVYDTGEAETPTGPLPYIVMEYVDGITLRDIVKEDGPMPIRRAIEVIA
DSCQALNFSHQHGIIHRDVKPANIMISKTGAVKVMDFGIARAVSDAGNSVTQTAAVIGTA
QYLSPEQARGETVDARSDVYSLGCVLYEMLTGEPPFVGDSPVAVAYQHVREDPVAPSKHN
PEIPPGLDSVVLKALSKNPDNRYQNAAEMRADLMRVYQGEQPEAPKVLTDAERSTMLNTP
PNTKAFPVQGAQTNELPNHYAEPRRNPLSRWLVGLAALVVLTVVVTFAIIWGSGPSRDVQ
VPDVTGKTQAEAVASLQNLGFKTKIQKNTSSKLAPDRVIDTDPAKGSTVTAGSEVTLNVS
IGPESQQVPDCHGLSFGDAVKKLQAAGFKGTFTQSETKSLPEDKGRVMATNPPAGQYSAV
TNNITIVVGKGPGEKPAPDLVGQNIDVAIKNLPNYGFTAPPTVITVPSPESKGQILSMNP
PANTMFPEDGVIEIRVSGGGQFRMPNLMGKFWTDAEPMLYQAGWQGGGLSTEDVPSDGGN
RARVVSQDPPAGAGVGYNGPIKLRFGAG
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgaccactccgcagcacctctcggaccgctatgagctgggggagatcctcggctatggc
ggcatgtccgaggttcacctggcgcgcgaccagcggttgaaccgcgacgtcgcgatcaag
gtgctgcgcgccgatctggcgcgggatcccagcttctatctgcgtttccgccgtgaggca
cagaacgccgccgcgctgaaccatcccgcgatcgtggcggtgtacgacaccggtgaggcc
gagacgcccaccgggccactgccgtacatcgtgatggaatacgtcgacggcatcaccctg
cgcgacatcgtcaaggaggacggcccgatgccgatccgccgggcgatcgaggtcatcgcc
gactcctgccaggcgctcaacttcagccaccagcacggcatcatccaccgcgacgtcaag
cccgccaacatcatgatcagcaagaccggcgcggtgaaggtgatggacttcggcatcgcg
cgcgcggtctcggatgccggcaacagcgtcacccagaccgccgccgtaatcggcaccgca
cagtatctttcgccggagcaggcccgtggcgagacggttgacgcccgctcggacgtctac
tcgctgggctgcgttctgtacgaaatgctcaccggtgagccgcctttcgtgggcgactca
cccgttgccgtcgcctaccagcatgtccgggaagaccccgtggcgccgtccaagcacaac
ccagagatccctccaggactggattccgttgtgctcaaagcgctttcgaagaaccctgac
aatcgctaccagaacgctgccgaaatgcgggccgacctgatgcgggtgtaccagggcgag
cagcccgaagcgccgaaggtcctcaccgacgccgaacgaagcaccatgctcaacacgccg
cccaacaccaaggccttcccggttcagggtgcacagaccaacgagctgcccaaccactac
gccgaaccgcggcgaaatccgttgagccgctggctggtcggcctagccgccctggtggtc
ctcaccgtggtggtcaccttcgcgatcatctggggcagtggaccctcgcgggacgtacaa
gttccggatgtcacgggcaaaacccaggccgaggccgtggccagcctgcagaacctcggc
ttcaagaccaagattcagaagaacaccagctcgaagctcgcacccgacagggtcatcgac
accgaccccgccaagggctcgaccgttaccgcaggctcagaggtcactctcaacgtgtcc
atcggaccggagagccagcaggtacccgactgccacggcctcagtttcggtgatgccgtc
aagaagctgcaggccgccggtttcaagggcacgttcacccagagcgagaccaagtcgctg
cccgaggacaagggccgagtcatggccaccaacccacccgcggggcagtactcggccgtc
accaacaacatcaccatcgtggtcggcaagggaccgggcgagaagccggcaccggatctc
gtgggccagaacatcgacgtcgccatcaaaaacctgcccaactacgggttcaccgcaccg
cccacagtcatcaccgttcccagccccgagtcgaaggggcagatcctgagcatgaacccg
ccagccaacacgatgttcccggaggacggggtcatcgagattcgggtctccggtggcggc
cagttccggatgccaaacctcatgggcaagttctggaccgatgccgagccgatgctctat
caggctgggtggcaaggcggaggcctcagcaccgaagacgtaccgtccgacggcggcaac
cgggcccgggtggtctcgcaggatccgccggccggtgccggtgtcggatacaacgggccg
atcaagctgcgcttcggcgcgggctag

DBGET integrated database retrieval system