KEGG   Mycobacteroides saopaulense: MYCSP_01200Help
Entry
MYCSP_01200       CDS       T05445                                 

Gene name
ligC
Definition
(GenBank) ATP-dependent DNA ligase
Organism
msao  Mycobacteroides saopaulense
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C mRNA_cap_enzyme PNKP_ligase
Motif
Other DBs
NCBI-ProteinID: ALR10310
LinkDB All DBs
Position
complement(241795..242859)
Genome map
AA seq 354 aa AA seqDB search
MDLPVMPPIAPMLAKPVAKIPADASYEPKWDGFRSIIFRDGEEVELGSRNEKPLTRYFPE
LVAAVLAELPQRCVIDGEIVIATEAGLDFEALQQRIHPADSRVRLLAEQTPASFVAFDLL
ALDDADYTDRPFSERRAALTDALSGAGTSIHLTPATTDQDTAQRWFEEFEGAGTDGLIAK
PLAIAYQPDKRVMFKIKPERTADCVVAGYRVHKSGDDAIGSLLLGLYQDDGALASVGVIG
AFPMAERKRLFQELQPLVTPLEDHPWNWAAHEAGERTPQKNAGSRWNAGKDLSFVALRPE
RVVEVRYDHMEGVRFRHTAQFNRWRPDRDPRSCTYEQLERPIEFSLNDIVPGLV
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggacctgcccgtcatgcctcctatcgcaccaatgctcgcgaaacctgtcgcgaaaatc
cccgcagacgcctcatatgagcccaagtgggatgggttcaggtcgatcatctttcgggat
ggcgaggaggtggaactgggcagccgcaacgagaagccgctgacccggtactttcccgag
ttggtcgcggcggtgctggccgagctgccgcagcggtgcgtgatcgacggggagatcgtg
atcgccaccgaagccggcctggatttcgaggcgctacagcagcggatccacccggccgat
tcccgggtccgtctgctggccgagcagacccccgcctcgttcgtcgcgttcgacctgctg
gcgctggacgacgcggactacacggatcggccgttcagcgagcgccgcgccgcgctgacg
gacgcgctctcgggtgccgggacctcgatacatctgacccccgccaccaccgatcaggac
accgcccagcgctggttcgaggagttcgagggtgccggcaccgacggcctcatcgccaaa
ccgttggccatcgcctatcaacccgataagcgggtgatgttcaagatcaagccggagcga
accgccgattgcgtggtcgcgggatatcgggtgcacaagtcgggtgacgacgcgatcgga
tcgctgctgctgggcctgtaccaggacgatggcgcactcgcctcggtcggcgtgatcggg
gcgttcccgatggccgagcgtaagcggctcttccaggaactgcagccgctcgtcacgccc
ctggaggatcacccctggaactgggccgcccatgaggccggtgagcgcaccccgcagaag
aacgccggctcccgctggaatgccggtaaagacctgtcatttgtcgcactgcgacccgag
cgggtggtcgaggtccgctacgaccacatggagggggtgcggttccgtcacaccgcacag
ttcaaccgctggcgtccggaccgcgatccgcgctcgtgcacctacgagcaactcgaacgg
ccaattgagttcagtctcaacgatattgttccgggcctggtgtga

DBGET integrated database retrieval system