KEGG   Mycobacteroides saopaulense: MYCSP_10330Help
Entry
MYCSP_10330       CDS       T05445                                 

Gene name
katE
Definition
(GenBank) hydroperoxidase
  KO
K03781  catalase [EC:1.11.1.6]
Organism
msao  Mycobacteroides saopaulense
Pathway
msao00380  Tryptophan metabolism
msao00630  Glyoxylate and dicarboxylate metabolism
msao01110  Biosynthesis of secondary metabolites
msao01130  Biosynthesis of antibiotics
msao01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:msao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MYCSP_10330 (katE)
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    MYCSP_10330 (katE)
Enzymes [BR:msao01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     MYCSP_10330 (katE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Catalase Catalase_C Catalase-rel DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: ALR14069
LinkDB All DBs
Position
2108777..2110885
Genome map
AA seq 702 aa AA seqDB search
MDSPSNPKQEQLDTSRVDRDSGYLTTQQGVRVDHTDDALTAGVRGPTLLEDFHAREKITH
FDHERIPERVVHARGAGAYGYFEPYDAWLSDFTAAKFLTTPGLRTPVFVRFSTVAGSRGS
ADTVRDVRGFATKFYTQQGNYDLVGNNFPVFFIQDGIKFPDFVHAVKPEPDNEIPQAASA
HDTLWDFVSQQPETLHAIMWLMSDRALPRSYRMMQGFGVHTFRLVNDTGEGVFVKFHWKP
MLGVHSLLWDECQQIAGKDPDYNRRDLWDAIEAGQYPEWELGVQLVPESDEFRFPFDLLD
ATKIIPEEQVPVQPVGRMVLDQNPDNFFAETEQVAFHTANVVPGIDFTNDPLLQFRNFSY
LDTQLIRLGGPNFAQLPINRPVAEVRNNQQDGFAQHDIPQGRSSYFKNTLGGGCPALAHE
DVFRHYTQRIDGHKIRQRAESFKDFYSQARMFWKSMSAIEAEHIVAAFSFELGKVGADTE
IRPRVVDQLNLVDSELAARVASRLGLPAPAQHSVEDTLPASPALSQLDTERDTIATRRVA
ILAADGVDVRGVERLRAALHKRHAITEVLAPVAGGVLNGEFGGELAVDRAMTTMASVLYD
AVIVPSGVESVGRLARNGYAVHFVSEAYKHLKPVAAFGAGLDLLRAAAVVETLATTTEVV
EDGGVVTTGAEDEGLPAEFVAVFAAALGRHRAWDRETEMVSA
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
gtggacagcccgtcgaatccgaaacaagaacaactcgacacgtcccgggtggaccgtgac
tctggctacttgaccacccagcaaggcgttcgcgtcgaccacaccgatgacgcactgacc
gcgggagtacgcggcccgaccctgctcgaagacttccatgctcgcgagaagattacacat
ttcgaccacgagagaattcccgagcgtgttgtccatgcgcgcggtgcgggtgcatacggc
tacttcgagccctacgacgcttggctttcggatttcacggccgcgaagtttctcaccacc
cccgggttgcggacaccggtgtttgtccggttctccaccgtggctggctcccggggttcg
gccgacacagtccgggatgtgcgcgggttcgcgacgaagttctatacccagcaaggaaat
tacgacctggtcggcaataacttccccgtcttctttatccaggacggcatcaagtttccg
gactttgtgcatgcggtgaagcctgagcccgacaacgagattccgcaggccgcctcggct
catgacacgttgtgggacttcgtctcccagcagccggagacgcttcacgccatcatgtgg
ctgatgtccgacagggcactgccacgcagttaccggatgatgcagggttttggcgtgcac
accttccgtctggttaacgacaccggcgaaggcgtatttgtgaagttccattggaagccg
atgctcggcgtgcattcgctgctctgggacgagtgccagcagatcgccggcaaggatccc
gattacaacaggcgtgatttatgggatgccattgaggcgggccagtatccggaatgggaa
ctcggggtgcagctcgtgccggaatccgatgagttcaggttccccttcgacctgctggat
gccaccaaaatcattccagaggagcaggttccggtgcagcccgtcggccggatggttctc
gatcagaatccggataacttcttcgcagaaaccgaacaggtggcttttcacacggctaac
gtcgttcctggaatcgacttcaccaacgatccgctgctgcagtttcgtaatttctcgtat
ctcgacacccagctgatccgtttgggcggacccaatttcgcgcagttgccgatcaatcgg
ccggtggccgaagtccgcaacaaccaacaggatggctttgcgcagcacgatattccgcag
ggcaggtcgagctacttcaagaacacactaggcggtgggtgtccggccctcgcccacgag
gatgtcttccgtcattacacacagcgcatcgacggtcacaagattcgtcagcgcgcagag
agtttcaaggacttctatagccaagcgcggatgttctggaagagcatgtcggccatcgaa
gccgaacatatcgtcgcagcattctcattcgaactcggaaaagtaggtgcagataccgag
attcgtcctcgtgtggtcgaccagctcaatctggtcgattccgagctggcggctcgggtg
gcttcacggctgggtctgcccgcccccgcacagcactcggtagaagacactctccccgct
tcccccgccctctcgcaactggacacggaaagggacaccatcgctacgcgacgtgtcgcg
atactggccgccgatggcgtggacgtgcgcggcgtcgagaggctgcgggcagccctgcac
aagcgccacgcaatcacagaggtgctcgcaccggtggcaggaggggtcttgaacggcgag
ttcggcggcgagctcgccgttgaccgggccatgaccaccatggcgtcggtcctctacgac
gcggtcatagtgccctccggagtggagtcggtcgggcggctggcgcgaaacggctatgcc
gtccatttcgtttcggaggcatacaaacacctcaagccggtcgcagccttcggtgccggc
cttgatctcctacgtgcagccgctgtcgtcgagacactggcaaccaccacagaggtggtg
gaggacggcggcgtggtgacgactggggcggaggatgagggcttgcccgctgagttcgtg
gcggtgttcgcggcggcgctcggtcggcaccgcgcgtgggatcgcgagaccgagatggtg
tcggcatag

DBGET integrated database retrieval system