KEGG   Mycobacteroides saopaulense: MYCSP_12750Help
Entry
MYCSP_12750       CDS       T05445                                 

Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
msao  Mycobacteroides saopaulense
Pathway
msao00400  Phenylalanine, tyrosine and tryptophan biosynthesis
msao01100  Metabolic pathways
msao01110  Biosynthesis of secondary metabolites
msao01130  Biosynthesis of antibiotics
msao01230  Biosynthesis of amino acids
Module
msao_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:msao00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MYCSP_12750
Enzymes [BR:msao01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     MYCSP_12750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 Cytidylate_kin2 KTI12 AAA_17 AAA_5 6PF2K AAA_22 AAA AAA_24 MMR_HSR1 Mg_chelatase AAA_28 Cytidylate_kin AAA_16 ABC_tran Ploopntkinase3 Viral_helicase1
Motif
Other DBs
NCBI-ProteinID: ALR12143
UniProt: A0A1S4VW23
LinkDB All DBs
Position
complement(2600959..2601600)
Genome map
AA seq 213 aa AA seqDB search
MSPKAVLVGLPGSGKSTIGRRLAKALNVNVYDTDTGIETEAGRTIADIFATDGEPEFRRI
EESVIRQALDQQDGVVSLGGGAVLTPGVREALAGHTVVYLEISATEGIRRTSGSVVRPLL
AGPNHAEKYQALMSQRVPLYREVATIKVNTDRRNPGAVVRMIVSRLENPETGTGPVSSRR
RRPRRRPRSRRRASGAPHTDTPGTQTKERADND
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgagccccaaagccgtcctcgtcgggctacccgggtcgggtaagtccaccatcggccgt
cgactggcaaaagcgttgaacgtcaatgtctatgacaccgataccggtatcgaaaccgag
gccgggcgcaccatcgccgatatcttcgccaccgacggagaaccggagttccggcgcatc
gaggaatcggtgattcggcaggcattggatcaacaagacggcgtggtctccttgggtggc
ggcgccgtgctcaccccgggcgttcgggaagccctggccgggcacaccgtggtgtatctg
gaaatcagtgctacggaaggcattcgacgtaccagtggcagcgtggtgcgtccgctgctg
gccgggccgaaccacgccgagaagtatcaggcactgatgtcgcagcgcgtaccgctgtac
cgggaggtcgccaccatcaaggtgaacaccgataggcgaaaccccggtgcggtggtgcgg
atgatcgtctcgcgattggagaaccctgagacgggtaccggtcccgtctcctcgcggcgg
cggcggcctcgtcggcgcccacgctcacggcgccgggcctcgggcgccccgcacaccgac
actcccggaacccaaaccaaggaaagagcagacaatgactag

DBGET integrated database retrieval system