KEGG   Mycobacteroides saopaulense: MYCSP_20630Help
Entry
MYCSP_20630       CDS       T05445                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
msao  Mycobacteroides saopaulense
Pathway
msao00250  Alanine, aspartate and glutamate metabolism
msao00410  beta-Alanine metabolism
msao00640  Propanoate metabolism
msao00650  Butanoate metabolism
msao01100  Metabolic pathways
msao01120  Microbial metabolism in diverse environments
Module
msao_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:msao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MYCSP_20630
   00650 Butanoate metabolism
    MYCSP_20630
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MYCSP_20630
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MYCSP_20630
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:msao01007]
    MYCSP_20630
Enzymes [BR:msao01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     MYCSP_20630
Amino acid related enzymes [BR:msao01007]
 Aminotransferase (transaminase)
  Class III
   MYCSP_20630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ALR13412
LinkDB All DBs
Position
complement(4189506..4190783)
Genome map
AA seq 425 aa AA seqDB search
MPVGLRASGSSATALSPVLKQATPVVAARGQGCYLYDESDREYLDFTAGIGVVSTGHCHP
RVVEAAQHQVATLIHGQYTTVMHRPLQNLVRRLGDVLPAGLDSLFFANSGSEAVEAAMRL
ARQATGRPNIVVFQGGFHGRTLAAATMTTSGPRFSSGIGPLMAGVYTAPFPTAYRYGWSE
GEATRFALQELDYLFATATAPNQVAAMVIEPVLGEGGYIPANTEFLTGIAERAREHGILL
VLDEVQTGFGRTGEYFGHQHFGVTPDILVMAKGIASGFPISGIAASAEVMGRAWPGSQGG
TYGANAVACAAALATLDVIEEEGLVENARARGRELLDGARKIAADRGIDGDVRGLGLMVG
VEFSQDGRPAAQLAARAQAAAAESGLLLLMCGPHMNVVRMIPPLVVTADQVSDALGIWST
VLAGL
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgtcggtcttcgcgcaagcggctcatccgcaaccgcgctatcgcccgttctcaag
caggccacccccgtggtggcggcgcgaggccagggttgctatctgtacgacgaaagtgac
cgcgaatacctggatttcaccgcgggtatcggtgtggtgagcaccggccactgccacccg
cgggtggtggaggcggcacagcaccaggtggccacgctcattcacgggcagtacaccacc
gtgatgcatcgtcccctgcagaacctggtgcggcgcctgggcgacgtgctgccggcgggt
ctggactcgctgttcttcgccaactccggcagtgaggccgtcgaggccgcgatgcggttg
gcgcgccaggctaccgggcggcccaatatcgttgtatttcaaggcggatttcacggacgc
acgctggccgccgccaccatgacgacgtcggggccgcggttctcttcgggcatcggcccc
ctgatggcgggtgtgtacaccgcaccgttccccaccgcatatcggtacggctggagtgag
ggcgaggccacccggttcgcgctgcaagagctcgactacctgttcgccaccgctaccgca
cccaaccaggtggcggcgatggtcatcgaaccggtgctcggcgagggtgggtacattccc
gccaataccgagttcctcaccggtatcgccgagcgcgcacgcgagcacggcatcctcttg
gtgctcgacgaggtgcagaccggattcgggcgcaccggagagtatttcggacatcagcac
ttcggcgtcacgccggatatcttggtgatggccaagggaatcgcgagcggattccccata
tcaggcatcgctgcctctgccgaggtgatggggcgcgcctggccgggatcgcagggcggc
acctacggcgccaacgccgtcgcgtgcgcggcggcgctggccactctcgacgtgatcgaa
gaggaaggccttgtcgaaaacgcgcgggcacggggtcgggaacttctcgacggtgcgcga
aagatcgccgcggataggggaatcgacggtgatgtgcgcgggctcgggctgatggttggt
gtcgagttcagccaggatggccgaccggcggcacagctggcggcccgtgcgcaggcagcg
gcggcggaaagcggtctgctgctgctcatgtgtggcccacacatgaacgtggtgcggatg
attccacctctggtggtgaccgccgaccaggtatccgatgccctcggcatctggagcacc
gtgttggcggggctgtga

DBGET integrated database retrieval system