KEGG   Mycolicibacterium smegmatis MC2 155: LJ00_00150Help
Entry
LJ00_00150        CDS       T03433                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
msb  Mycolicibacterium smegmatis MC2 155
Brite
KEGG Orthology (KO) [BR:msb00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:msb01001]
    LJ00_00150
Enzymes [BR:msb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     LJ00_00150
Protein kinases [BR:msb01001]
 Serine/threonine kinases: Other
  Bacterial family
   LJ00_00150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH Pkinase_fungal Kinase-like Haspin_kinase RIO1 DUF3999 ABC1
Motif
Other DBs
NCBI-ProteinID: AIU05314
UniProt: I7F4E4 A0QNG2
LinkDB All DBs
Position
complement(50089..51348)
Genome map
AA seq 419 aa AA seqDB search
MSPRVGVTLSGRYRLQRLIATGGMGQVWEAVDSRLGRRVAVKVLKAEFSTDAEFVERFRA
EARTVAMLNHPGIASVYDYGETELDGEGRTAYLVMELINGEPLNSVLKRTGRLSLRHALD
MLEQTGRALQVAHTAGLVHRDVKPGNILITPTGQVKLTDFGIAKAVDAAPVTQTGMVMGT
AQYIAPEQALGHDATAASDVYSLGVVGYESVSGKRPFTGDGALTVAMKHIKETPPPLPAD
LPPNVRELIEITLVKNPGMRYKSGGPFADAVAAVRAGRRPPRPNQAPTLGRAAPAAVPSA
AQARASADLTGRAPVTAARARPTATAAHRTPPPRRTFSSGQRALLWAAGVLGALAIVIAI
LIVLNAQDRKDREQSPPPTVTDTVTETTPYEETPAAMPDLMIMLRAAQPEPPPSEQIQR
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgagcccgcgcgttggagtcacgctgtccggtcgttaccggctgcagcggctgatcgcc
acgggcggtatgggccaggtgtgggaggccgtggattcgcggctgggccgccgggtcgcc
gtcaaggtgctcaaggccgagttctccaccgacgccgagttcgtcgaacgcttccgggcc
gaggcccgcaccgtcgcgatgctcaaccatcccggcatcgcgagcgtgtacgactacggc
gagaccgaactcgacggcgagggccgcaccgcgtacctggtgatggagctcatcaacggt
gagccgctgaactcggtgctcaagcgcaccggccggctgtcgctgcggcacgcgctggac
atgctggagcagaccggccgtgcgctgcaggtcgcgcacaccgcgggcctggtgcaccgc
gacgtcaagcccggcaacatcctcatcaccccgacggggcaggtgaagctcaccgacttc
ggcatcgccaaggccgtcgacgccgcgccggtcacccagaccggcatggtgatgggcacc
gcgcagtacatcgcgcccgagcaggccctgggccatgacgcgaccgccgccagtgacgtg
tattcgctgggcgtcgttggctacgaatcggtttcgggcaagcgcccgttcaccggcgac
ggtgcgctgacggtcgcaatgaagcacatcaaggagaccccgccgccgcttccggccgat
ctgccgccgaacgtgcgcgagctgatcgagatcacgctcgtgaagaacccgggcatgcgg
tacaagtcgggcggcccgttcgccgacgcggtcgccgcggtgcgcgcgggtcgcaggcca
ccgcggcccaaccaggcaccgacgctgggacgtgccgcaccggccgcggtgccgtcggcc
gcgcaggcccgtgcctctgccgatctcacgggccgtgcgcccgtcaccgccgcacgcgcg
agacccaccgcgacggccgcgcatcggactccgccgcctcgacgcacgttctcctcgggg
caacgggcgctattgtgggcggctggcgtcctcggcgcgttggccatcgtgatcgcgatc
ctgatcgtgctcaacgcgcaggaccgcaaggaccgcgagcagtcgccaccgccgacggtc
accgacaccgtcaccgagacgacgccctacgaggagaccccggcggcgatgcctgacctc
atgatcatgttgcgtgcggctcagcccgagccgccgccatccgaacagatacagcgatga

DBGET integrated database retrieval system